SecReT6
Protein ID: 167033766
SecReT6 ID252
T6SS typei4b
Gene symbol-
Locus tagPputGB1_2767
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3103089..3104909 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDB0KTH4
KEGG IDppg:PputGB1_2767
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.90E-210, Aligned region: 5..606
Protein Sequence: 606 a.a.     [Download]
>gi|167033766|ref|YP_001668997.1| unnamed protein product [Pseudomonas putida GB-1]
MLDELLPYYEKELSHLRFLGQEFAAQYPKIASRLLIEGDNCEDPHTERLIEAFSFLSARVHKKLDDEFPE
IVESFLEVLYPHYLRPTPSMSIAELSLGRHEKVTEAYHVARHTEMHANAVEGVVCKFRTCYPVELWPIAV
QQASFAEMERSAFNGHSADLVARLRIRLTATGDALFGQMEMDRLRFFLDGEATLMLHLYELLFNNLAKAT
LSFHDEGRSREVALPAGALKAVGFTRDEGLVDYSERSFLGYRLLHEYFTFPDKFMFFDLSGFARILQGKA
IEQVEINFYFSDYDLSERLARLTQNIGRNNFKLNCTPIINLFRQQAEPIKLTHTQHEYPVTPDTRLHNAA
EVVSIDRVRRVRKLGGIDQVTTCLPFFEPRGEQDPHSSFWVARRRNQGDATAMSIRVVDRDLELIGASSD
TLSIGLTCSNRDVPLMLPFGGERGDFNIPANSVIKDIRCLRKPTATVRVPLGKGLIWRLIAHLSLNHMSL
VSQGREVLLELLSLYNYRNVSAIRKQINGIKAISSEPVVARIGHPRPNFVRGVGITLTLDEHQYTGSGVF
LFGMVLDHFFGQYCSMNSFTQLTLRTQQREKRIVQWPARTGDQPLV
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3103089-3104909 Pseudomonas putida GB-1 chromosome, complete genome
ATGCTCGACGAACTGCTGCCCTACTACGAAAAGGAACTGTCGCACCTGCGCTTCCTCGGCCAGGAGTTTG
CTGCGCAGTACCCGAAAATCGCTTCTCGTTTGCTGATCGAGGGCGACAACTGCGAGGACCCGCATACCGA
GCGCCTGATCGAGGCGTTCTCGTTCCTTTCTGCGCGGGTGCACAAGAAGCTCGATGACGAGTTCCCGGAA
ATCGTCGAATCCTTCCTCGAGGTGCTGTACCCGCATTACCTGCGCCCGACCCCGTCCATGTCGATTGCCG
AGTTGAGCCTGGGCAGGCATGAGAAAGTCACCGAGGCATACCACGTGGCGCGCCATACCGAAATGCATGC
CAATGCCGTCGAGGGCGTGGTGTGCAAGTTCCGCACCTGTTACCCCGTAGAGCTGTGGCCGATTGCCGTG
CAACAGGCCTCGTTCGCCGAAATGGAACGCTCGGCATTCAATGGCCACAGCGCCGACCTGGTCGCACGCC
TGCGTATCCGCCTGACCGCCACAGGTGATGCCCTGTTCGGGCAGATGGAAATGGACCGCCTGCGGTTTTT
CCTCGACGGCGAAGCCACGCTGATGCTGCATCTATATGAGTTGCTGTTCAACAACCTGGCCAAGGCCACC
CTGAGCTTCCACGACGAGGGCCGCAGCCGTGAAGTCGCGCTGCCAGCCGGTGCGCTAAAGGCCGTGGGTT
TTACCCGTGACGAAGGCCTGGTGGATTACTCCGAGCGCTCGTTCCTGGGCTACCGGCTGCTGCACGAGTA
TTTCACCTTCCCCGACAAATTCATGTTCTTCGACCTCAGTGGTTTTGCACGCATCCTGCAAGGCAAGGCT
ATCGAGCAGGTCGAGATCAATTTCTATTTTTCCGACTACGACCTCAGCGAGCGCCTGGCGCGGCTGACGC
AGAACATCGGGCGCAACAATTTCAAGCTCAACTGCACGCCAATCATCAATCTGTTCCGCCAGCAGGCCGA
GCCGATCAAGCTGACCCACACCCAGCACGAGTACCCGGTCACGCCTGATACCCGGCTGCACAACGCTGCC
GAAGTGGTGTCGATCGACCGCGTGCGCCGGGTGCGCAAACTTGGCGGCATCGACCAGGTCACCACCTGCC
TGCCGTTTTTCGAGCCCCGTGGCGAACAGGACCCGCACAGCAGCTTCTGGGTCGCCCGTCGGCGCAATCA
GGGTGACGCCACGGCCATGAGCATCCGCGTGGTCGACCGTGACCTGGAGCTGATCGGCGCCAGCAGCGAC
ACCCTCAGCATCGGCCTCACCTGCAGCAACCGCGATGTGCCGCTGATGCTGCCGTTCGGTGGCGAGCGTG
GCGATTTCAACATTCCCGCCAACTCGGTAATCAAGGACATCCGCTGCCTGCGCAAGCCCACTGCCACCGT
GCGCGTGCCCTTGGGAAAAGGCTTGATCTGGCGGCTGATCGCGCACCTGTCGCTGAACCATATGTCGCTG
GTCAGCCAAGGCCGCGAAGTGCTGCTGGAACTGCTGTCGCTCTACAACTACCGCAACGTGTCGGCCATCC
GCAAACAGATCAATGGCATCAAGGCCATCAGCAGCGAGCCAGTGGTTGCGCGCATCGGCCATCCGCGGCC
GAATTTTGTGCGGGGCGTAGGCATTACCCTCACCCTCGACGAGCACCAATACACCGGCAGCGGCGTGTTC
CTGTTCGGCATGGTGCTGGACCACTTCTTCGGCCAGTACTGCTCGATGAACAGCTTCACCCAACTGACCC
TGCGTACCCAACAACGAGAAAAGAGAATCGTCCAATGGCCAGCACGCACTGGCGATCAGCCCCTGGTCTG
A