SecReT6
Protein ID: 167033767
SecReT6 ID252
T6SS typei4b
Gene symbol-
Locus tagPputGB1_2768
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3104873..3105943 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDB0KTH5
KEGG IDppg:PputGB1_2768
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-103, Aligned region: 17..333
Protein Sequence: 356 a.a.     [Download]
>gi|167033767|ref|YP_001668998.1| unnamed protein product [Pseudomonas putida GB-1]
MASTHWRSAPGLIDQARAEPHRFEFFQLVRLLRLHYSRTGRMDLATRPHEDPLRFRTQLSLAFPASEVSD
LHFEREGKLSPAGLPLSEVQVTFMGLVGPSGVLPRPYTELLLERHVQYRDDAAHAFLDIFSHRMTTLFYE
AWQKYKFHIEHERNGTSGFDGYLLNLAGFGPRAQKLKFEEQPSVLRRELFSYFAGLLSQKPRNALNLERM
LGFYFSLPIHVKQFAGRWLHLPPEQRTQLGRRNAQLGQSAVAGKRTWDYQSCIRIELGPLSLADYQRFQP
GTECYRKLVELVRFYIGAGLDFEIAPRLKREAVPRAQLGRKGNVALGWLGWLKRPGRDAEPSRCAVFHIP
YDGVAL
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3104873-3105943 Pseudomonas putida GB-1 chromosome, complete genome
ATGGCCAGCACGCACTGGCGATCAGCCCCTGGTCTGATCGATCAGGCCCGAGCCGAGCCGCACCGATTCG
AATTCTTTCAATTGGTGCGCCTGCTCCGCCTGCACTACAGCCGCACCGGTCGCATGGACCTGGCAACCCG
GCCCCATGAAGACCCGCTGCGTTTCCGCACCCAGTTGTCGCTAGCATTTCCGGCCAGCGAGGTCAGCGAC
CTGCACTTTGAGCGCGAAGGCAAGCTATCGCCGGCTGGCCTGCCACTGTCGGAAGTGCAGGTTACCTTCA
TGGGCCTGGTCGGGCCGTCGGGCGTGCTGCCGCGCCCGTATACCGAGTTGCTGCTCGAGCGCCATGTGCA
ATACCGCGACGATGCCGCCCATGCGTTTCTCGACATCTTCTCGCACCGTATGACCACGCTGTTCTACGAG
GCCTGGCAAAAATACAAGTTCCATATCGAGCACGAGCGCAATGGCACCTCGGGTTTCGATGGCTACCTGC
TCAACCTGGCGGGCTTCGGGCCGCGCGCGCAAAAACTGAAGTTCGAAGAACAACCGTCAGTATTGCGTCG
TGAGCTGTTCAGCTATTTTGCCGGCCTGCTCAGCCAGAAGCCGCGCAATGCGCTGAACCTCGAACGGATG
CTCGGCTTCTATTTCTCGTTGCCGATCCACGTCAAGCAGTTCGCCGGTCGTTGGTTGCACCTGCCGCCTG
AACAGCGCACCCAGCTTGGGCGGCGCAACGCCCAGCTCGGCCAAAGCGCCGTAGCGGGCAAGCGAACCTG
GGATTACCAATCGTGCATTCGCATCGAGCTGGGCCCACTGAGCCTGGCCGATTACCAGCGTTTTCAGCCG
GGCACCGAGTGCTATCGCAAGCTGGTCGAGTTGGTGCGCTTCTATATAGGTGCCGGGCTGGACTTCGAAA
TCGCCCCGCGCCTCAAGCGCGAGGCAGTGCCACGCGCCCAGCTCGGCCGCAAAGGCAATGTCGCCTTGGG
CTGGCTGGGCTGGCTCAAACGCCCTGGCCGTGACGCGGAGCCTTCGCGTTGCGCCGTTTTCCACATTCCT
TACGATGGGGTCGCCTTGTGA