SecReT6
Protein ID: 167033768
SecReT6 ID252
T6SS typei4b
Gene symbol-
Locus tagPputGB1_2769
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3105940..3108537 [+]
Producttype VI secretion ATPase
NoteTssH
UniProt IDB0KU00
KEGG IDppg:PputGB1_2769
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.00E-44, Aligned region: 34..46
AAA_2 [PF07724], Evalue: 7.00E-44, Aligned region: 225..245
AAA_2 [PF07724], Evalue: 7.00E-44, Aligned region: 596..763
AAA_2 [PF07724], Evalue: 7.00E-44, Aligned region: 817..837
AAA [PF00004], Evalue: 5.00E-19, Aligned region: 59..79
AAA [PF00004], Evalue: 5.00E-19, Aligned region: 225..338
AAA [PF00004], Evalue: 5.00E-19, Aligned region: 602..720
AAA_5 [PF07728], Evalue: 3.10E-14, Aligned region: 225..247
AAA_5 [PF07728], Evalue: 3.10E-14, Aligned region: 386..447
AAA_5 [PF07728], Evalue: 3.10E-14, Aligned region: 601..722
ClpB_D2-small [PF10431], Evalue: 6.70E-14, Aligned region: 772..843
AAA_22 [PF13401], Evalue: 3.30E-09, Aligned region: 224..311
AAA_22 [PF13401], Evalue: 3.30E-09, Aligned region: 342..443
AAA_22 [PF13401], Evalue: 3.30E-09, Aligned region: 468..515
AAA_22 [PF13401], Evalue: 3.30E-09, Aligned region: 599..638
AAA_16 [PF13191], Evalue: 1.10E-08, Aligned region: 75..152
AAA_16 [PF13191], Evalue: 1.10E-08, Aligned region: 202..248
AAA_16 [PF13191], Evalue: 1.10E-08, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 1.10E-08, Aligned region: 467..517
AAA_16 [PF13191], Evalue: 1.10E-08, Aligned region: 596..642
AAA_16 [PF13191], Evalue: 1.10E-08, Aligned region: 666..690
AAA_16 [PF13191], Evalue: 1.10E-08, Aligned region: 784..801
Sigma54_activat [PF00158], Evalue: 5.20E-07, Aligned region: 221..258
Sigma54_activat [PF00158], Evalue: 5.20E-07, Aligned region: 601..727
Clp_N [PF02861], Evalue: 7.00E-07, Aligned region: 21..73
Clp_N [PF02861], Evalue: 7.00E-07, Aligned region: 103..129
Arch_ATPase [PF01637], Evalue: 1.80E-06, Aligned region: 204..239
Arch_ATPase [PF01637], Evalue: 1.80E-06, Aligned region: 278..379
Arch_ATPase [PF01637], Evalue: 1.80E-06, Aligned region: 600..642
Arch_ATPase [PF01637], Evalue: 1.80E-06, Aligned region: 667..695
AAA_19 [PF13245], Evalue: 9.00E-06, Aligned region: 225..246
AAA_19 [PF13245], Evalue: 9.00E-06, Aligned region: 599..623
AAA_17 [PF13207], Evalue: 1.10E-05, Aligned region: 225..319
AAA_17 [PF13207], Evalue: 1.10E-05, Aligned region: 602..639
NACHT [PF05729], Evalue: 1.70E-05, Aligned region: 225..254
NACHT [PF05729], Evalue: 1.70E-05, Aligned region: 601..626
NACHT [PF05729], Evalue: 1.70E-05, Aligned region: 709..738
AAA_14 [PF13173], Evalue: 4.30E-05, Aligned region: 225..358
AAA_14 [PF13173], Evalue: 4.30E-05, Aligned region: 600..682
IstB_IS21 [PF01695], Evalue: 8.20E-05, Aligned region: 219..247
IstB_IS21 [PF01695], Evalue: 8.20E-05, Aligned region: 601..620
AAA_18 [PF13238], Evalue: 0.0005, Aligned region: 225..267
AAA_18 [PF13238], Evalue: 0.0005, Aligned region: 603..626
Zeta_toxin [PF06414], Evalue: 0.00094, Aligned region: 220..249
Zeta_toxin [PF06414], Evalue: 0.00094, Aligned region: 595..641
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 218..241
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 599..626
AAA_25 [PF13481], Evalue: 0.0013, Aligned region: 225..249
AAA_25 [PF13481], Evalue: 0.0013, Aligned region: 282..320
AAA_25 [PF13481], Evalue: 0.0013, Aligned region: 350..380
AAA_25 [PF13481], Evalue: 0.0013, Aligned region: 481..513
AAA_25 [PF13481], Evalue: 0.0013, Aligned region: 599..625
AAA_23 [PF13476], Evalue: 0.0057, Aligned region: 225..241
AAA_23 [PF13476], Evalue: 0.0057, Aligned region: 464..501
AAA_23 [PF13476], Evalue: 0.0057, Aligned region: 599..698
RNA_helicase [PF00910], Evalue: 0.0093, Aligned region: 226..246
RNA_helicase [PF00910], Evalue: 0.0093, Aligned region: 602..623
RNA_helicase [PF00910], Evalue: 0.0093, Aligned region: 702..720
Protein Sequence: 865 a.a.     [Download]
>gi|167033768|ref|YP_001668999.1| unnamed protein product [Pseudomonas putida GB-1]
MNLKSLFAKLNETSRTATESAAALCLSEHHYDVEVEHLLLQLLDSSDNDLAPILRHYEVVTERLQAQLVT
ALGTFKKGNTRTPALSPHITRMIEQAWLLASIEYGVGQVRSGHLLQALLDDAELRRVVMASAPELEKINA
NDLRLNLAALVEGSAESRQASPLASPAAPIASSTKAGGKTPALDQYTVNLTQSAREGRIDPVLGREFEVR
QMVDILTRRRQNNPILTGEAGVGKTAVVEGLALRIAQGDVPAVLKDVALHTLDLGLLQAGAGVKGEFENR
LKAVIEEVKRSLHPIILFIDEAHTLIGSGGQAGQNDAANLLKPALARGELRTIAATTWAEYKKYFEKDAA
LARRFQVVKVEEPDEDKAIHMLRGLLGKMREHHKVAVMDEALVQAVRLSNRYITGRQLPDKAVSVLDTAC
ARIALAQSSQPGLLEDCRRQIDNLQAEIAVLGHEAGKGHDHARRLGELQAALQTEQQREQQLIAQWQQEL
ELVEQLKALDAANDTDAEQLNTLRAELARVQGDQPLVHALVDSGAIAQVISGWTGIPLGKMLRDEIDTVQ
RLPALLGERVLGQDHALQEIGKRIKISRARMEDPNKPIGVFLLLGPSGVGKTETALALADTLYGGERNLI
TINMSEYQEAHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVLELFFQVFDKGVLD
DGEGREINFRNTVIILTSNTGTERIMQTCLNATELPTPEAIVEGLRNELNQVFKPAFLGRLNIVPFYPVQ
DQILERIVALKLERIAKRFARNHQAELGYDEALVKAIAARCTEVDSGARNIDNILSQTLMPELAQRVLER
MAQDTPIERLVIELGSDGDFAYRLA
 
Nucleotide Sequence: 2598 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3105940-3108537 Pseudomonas putida GB-1 chromosome, complete genome
GTGAACCTGAAGTCTCTGTTCGCCAAGCTAAACGAAACCAGCCGCACGGCCACCGAAAGCGCGGCGGCCC
TGTGCCTGTCGGAGCATCACTACGATGTCGAGGTTGAGCACCTGCTGCTGCAACTGCTCGACAGCAGTGA
CAATGACCTGGCACCGATCCTGCGCCACTATGAGGTCGTCACCGAGCGCCTGCAGGCGCAACTGGTCACC
GCCCTGGGCACCTTCAAGAAAGGCAATACCCGTACCCCAGCGCTGTCGCCGCACATCACCCGCATGATCG
AGCAGGCCTGGTTGCTGGCATCGATCGAGTATGGCGTTGGCCAAGTACGCAGCGGCCACTTGCTGCAAGC
CCTGCTTGATGATGCCGAACTGCGCCGAGTGGTGATGGCTTCGGCACCGGAGCTGGAAAAGATCAATGCC
AATGACCTGCGCCTGAACCTTGCCGCACTGGTCGAAGGTAGCGCCGAGTCGCGGCAGGCCAGCCCCCTGG
CCAGCCCCGCAGCACCGATTGCCAGCAGCACTAAAGCTGGGGGCAAGACCCCAGCGCTGGACCAGTACAC
CGTCAACCTTACCCAAAGTGCCCGCGAAGGCCGCATTGACCCAGTCCTGGGCCGCGAGTTCGAAGTGCGG
CAAATGGTCGACATCCTCACCCGTCGCCGGCAAAACAACCCGATTCTCACCGGTGAAGCCGGGGTCGGCA
AAACCGCCGTGGTCGAGGGCCTGGCCCTGAGAATCGCCCAGGGCGATGTACCAGCGGTGCTCAAGGATGT
GGCCCTGCACACCCTTGACCTGGGCCTGCTGCAGGCGGGCGCCGGGGTAAAGGGCGAGTTCGAAAACCGC
CTGAAAGCGGTCATCGAAGAGGTCAAGCGCAGCCTGCACCCAATCATCCTGTTCATCGACGAAGCCCACA
CCCTGATCGGTTCTGGCGGCCAGGCCGGGCAGAACGATGCCGCCAACCTGCTCAAGCCGGCCCTTGCCCG
TGGCGAACTGCGCACCATCGCCGCCACCACCTGGGCCGAATACAAGAAGTACTTCGAGAAAGACGCCGCC
CTCGCCCGCCGCTTTCAGGTAGTAAAGGTCGAAGAACCTGATGAAGACAAAGCCATTCACATGCTGCGCG
GGCTACTGGGCAAGATGCGCGAGCACCACAAGGTGGCGGTGATGGACGAAGCGCTGGTACAAGCGGTGCG
CCTGTCCAACCGCTACATCACCGGCCGCCAGCTGCCCGACAAAGCCGTTAGCGTGCTCGACACCGCCTGC
GCCCGCATCGCCCTGGCGCAGTCGTCGCAGCCAGGCTTGCTGGAAGACTGCCGTCGGCAGATCGACAACC
TGCAGGCAGAAATCGCCGTTCTTGGCCACGAAGCGGGCAAAGGCCATGACCATGCCCGTCGCCTAGGCGA
GCTGCAGGCCGCGTTGCAGACCGAACAGCAGCGCGAGCAGCAGCTCATCGCGCAGTGGCAACAGGAGCTG
GAACTGGTCGAGCAACTCAAGGCACTGGATGCCGCCAACGACACCGACGCCGAGCAGCTCAATACCCTGC
GCGCCGAACTGGCCCGTGTGCAAGGTGACCAGCCACTGGTCCACGCCCTGGTCGACAGCGGCGCCATTGC
CCAGGTCATCAGCGGCTGGACCGGCATCCCGCTGGGCAAGATGCTGCGCGACGAAATCGATACCGTACAG
CGCCTGCCGGCCCTGCTGGGCGAGCGCGTACTGGGCCAGGACCATGCCCTGCAGGAAATCGGCAAACGCA
TCAAGATTTCCCGTGCGCGCATGGAAGACCCCAACAAACCCATCGGCGTGTTCCTGCTGCTCGGCCCCAG
CGGCGTCGGCAAGACCGAAACTGCCCTGGCCCTGGCCGATACGCTGTACGGCGGCGAGCGCAACCTGATC
ACCATCAACATGTCCGAGTACCAGGAGGCCCACACCGTGTCGAGCCTCAAAGGCTCGCCCCCCGGCTACG
TCGGTTACGGCGAAGGCGGCGTGCTGACCGAGGCGGTACGCCGCAAACCCTACAGCGTGGTGCTGCTGGA
CGAGGTGGAAAAAGCCCACCCCGACGTACTCGAACTGTTTTTCCAGGTCTTCGACAAGGGCGTGCTGGAC
GACGGTGAAGGCCGCGAGATCAACTTCCGCAACACAGTGATCATCCTCACCTCCAACACCGGCACCGAAC
GCATCATGCAAACCTGCCTGAATGCCACCGAGCTGCCAACGCCAGAGGCCATCGTCGAAGGCCTGCGCAA
CGAGCTCAACCAAGTGTTCAAGCCGGCGTTTCTCGGCCGCCTGAACATCGTGCCGTTCTACCCGGTGCAG
GACCAGATCCTCGAGCGCATCGTCGCCCTCAAGCTCGAGCGTATCGCCAAGCGCTTCGCCCGCAACCACC
AGGCCGAGTTGGGCTACGACGAGGCGCTGGTCAAAGCCATCGCCGCCCGTTGCACCGAGGTCGACAGCGG
CGCACGCAACATCGACAACATCCTGTCGCAAACCCTGATGCCCGAGCTCGCCCAGCGTGTGCTCGAACGC
ATGGCCCAGGACACACCGATCGAGCGCCTTGTGATCGAACTGGGCAGCGATGGCGATTTCGCCTATCGCC
TGGCCTGA