SecReT6
Protein ID: 167033770
SecReT6 ID252
T6SS typei4b
Gene symbol-
Locus tagPputGB1_2771
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3109281..3110624 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDB0KU02
KEGG IDppg:PputGB1_2771
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.00E-136, Aligned region: 19..445
Protein Sequence: 447 a.a.     [Download]
>gi|167033770|ref|YP_001669001.1| unnamed protein product [Pseudomonas putida GB-1]
MSKQSRVMWSEGMFLLPQHFQYQDEFHQHQLAEATLRSTPFHWGVQALQVDEDALANGSLQLKRLKLVFP
DGSLYDAPQHDPLPAARDLKDLLKANDLKVYAALKLPEPFGLNYVEDGHEHKAARRFRKQFDTLPDLNEG
ELENEITSLRLNVVMLVDGDSLDGYSYCPLAKLTRNSMGGFNLDPHFVHPTLHLGSHETITSLGKRLLGA
LQAKSKALSGRRRERADQIAEFGSSDVTLFWLLNTVNRAHPQLAHLLAHPRLHPERLYLFLADLAGGLLT
FTLDTQLSDIPEYDHQDPAASLVKLDEMIRVMLDNVVPNQCIVINLTQTKPSHWQGQLHDPRLAEADFYI
AVHADMPGASLLELVPRAFKVGSPEDIEVVVNSAMPGVTLNHAARLPNAIPVRLDNQYFAIEPHGTVYER
MINAQAICFYAPSAFTNLKLELMAVLK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3109281-3110624 Pseudomonas putida GB-1 chromosome, complete genome
ATGAGCAAGCAGAGCCGGGTGATGTGGTCGGAAGGCATGTTCCTGCTGCCCCAGCACTTCCAGTACCAGG
ACGAGTTCCACCAGCACCAGTTGGCTGAGGCGACCCTGCGCAGTACTCCTTTCCATTGGGGTGTACAGGC
GCTGCAGGTGGACGAAGACGCCCTGGCCAACGGTTCGCTGCAGCTCAAGCGCCTGAAGCTGGTGTTCCCT
GATGGCAGCCTGTACGACGCTCCGCAGCACGATCCGCTGCCGGCCGCGCGTGACCTCAAGGACCTGCTCA
AGGCCAACGACCTGAAGGTTTATGCCGCGCTCAAGCTGCCCGAGCCATTCGGCCTCAATTACGTCGAGGA
TGGCCACGAGCACAAGGCCGCACGGCGCTTTCGCAAGCAGTTCGACACCCTGCCCGACCTTAATGAAGGT
GAGCTGGAGAACGAGATCACCAGCCTGCGCCTGAACGTGGTCATGCTGGTCGACGGCGACAGCCTCGATG
GCTACAGCTACTGCCCGCTGGCGAAGCTGACACGCAACAGCATGGGCGGCTTCAACCTCGACCCGCATTT
CGTCCACCCTACCCTGCACCTGGGCAGCCACGAAACCATCACCAGCCTCGGCAAACGCCTGCTCGGTGCC
CTGCAGGCCAAGAGCAAGGCGCTGTCCGGCCGACGCCGCGAGCGCGCCGACCAGATCGCCGAGTTCGGCT
CCAGCGACGTCACCTTGTTCTGGCTGTTGAACACGGTCAACCGTGCCCACCCGCAATTGGCGCATCTGCT
GGCCCATCCGCGCCTGCACCCGGAGCGCCTGTACCTGTTCCTCGCCGACCTGGCCGGCGGGCTCCTGACC
TTCACCCTGGACACCCAGCTCAGCGACATCCCCGAGTACGACCACCAGGACCCTGCGGCATCGCTGGTGA
AACTGGACGAAATGATCCGCGTAATGCTCGACAACGTGGTGCCCAACCAGTGCATCGTCATCAACCTGAC
CCAGACCAAACCGTCCCATTGGCAAGGCCAGCTGCACGACCCACGCCTGGCCGAAGCCGACTTCTATATT
GCCGTGCACGCCGACATGCCCGGTGCCAGCCTGCTGGAACTGGTGCCCCGAGCGTTCAAGGTCGGCTCGC
CGGAAGACATCGAGGTGGTGGTCAACAGCGCCATGCCTGGCGTCACCCTCAATCATGCCGCGCGGTTACC
GAACGCGATTCCGGTGCGCCTGGATAACCAGTATTTCGCCATCGAGCCGCACGGCACTGTGTATGAGCGA
ATGATCAATGCCCAGGCCATCTGCTTCTATGCGCCCAGCGCCTTTACCAACCTCAAGCTTGAACTGATGG
CGGTGCTCAAATGA