SecReT6
Protein ID: 167033771
SecReT6 ID252
T6SS typei4b
Gene symbol-
Locus tagPputGB1_2772
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3110621..3111337 [+]
Producthypothetical protein
NoteTssL
UniProt IDB0KU03
KEGG IDppg:PputGB1_2772
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.10E-53, Aligned region: 19..221
Protein Sequence: 238 a.a.     [Download]
>gi|167033771|ref|YP_001669002.1| unnamed protein product [Pseudomonas putida GB-1]
MTEAVLQQGAVAAANDKPTLKDLVQDFISMALIVRRGRQVTSVPAFEGSVERFFANLERDARAANYSVEQ
VKDTQYALCAFLDESVLRSGDNALRRHFELQPLQFRYFGVHLAGEGFFEKVQALRADTKQNVDVLEVYHL
CLALGFEGKFSLGQKDQLRYLANTLGQDIARYRKAPKALSPDWALPDQVSQMLRHEVPLWVYLALIALVC
VAVYLTLDWLLDKDVAALSEQIRQLFSA
 
Nucleotide Sequence: 717 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3110621-3111337 Pseudomonas putida GB-1 chromosome, complete genome
ATGACCGAAGCCGTACTGCAACAGGGCGCCGTCGCGGCCGCCAACGACAAACCGACGCTCAAGGACCTGG
TCCAGGACTTCATCAGCATGGCGCTGATCGTACGTCGCGGCCGCCAGGTCACCTCGGTGCCGGCCTTCGA
GGGCAGCGTAGAACGCTTCTTCGCCAACCTGGAGCGGGATGCCCGCGCGGCCAACTACAGCGTCGAGCAG
GTCAAGGACACTCAGTACGCGCTGTGCGCGTTCCTTGATGAAAGCGTGCTGCGCTCAGGCGACAACGCGC
TGCGTCGGCATTTTGAGCTGCAGCCGTTGCAGTTCCGCTATTTCGGTGTGCACCTGGCCGGGGAAGGTTT
CTTCGAAAAAGTCCAAGCGCTGCGTGCTGACACCAAGCAAAACGTCGATGTGCTCGAGGTCTACCACCTG
TGCCTGGCCCTGGGCTTCGAGGGCAAGTTCAGCCTTGGCCAGAAAGACCAGCTGCGTTACCTGGCCAATA
CCCTGGGCCAGGACATTGCCCGCTACCGCAAGGCGCCCAAAGCGCTGTCACCGGACTGGGCACTGCCCGA
CCAGGTGTCGCAGATGCTGCGCCATGAAGTGCCGCTGTGGGTGTATCTGGCGCTGATCGCGCTGGTCTGC
GTCGCCGTGTACCTGACGCTTGACTGGTTGCTGGACAAGGACGTTGCCGCCCTGTCCGAACAAATCCGCC
AGCTGTTCAGTGCCTGA