SecReT6
Protein ID: 167033776
SecReT6 ID252
T6SS typei4b
Gene symbol-
Locus tagPputGB1_2777
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3119309..3120406 [+]
ProductImpA family type VI secretion-associated protein
NoteTssA
UniProt IDB0KU08
KEGG IDppg:PputGB1_2777
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.20E-22, Aligned region: 58..118
ImpA-rel_N [PF06812], Evalue: 6.20E-22, Aligned region: 241..258
Protein Sequence: 365 a.a.     [Download]
>gi|167033776|ref|YP_001669007.1| unnamed protein product [Pseudomonas putida GB-1]
MPEILNDLSLATLAAPIEGGSGEDLSFSALFDQIKEARRADPDYLTQGDWQTDLKTADWEQVINLSAQGL
AQQSKDLMLVAWLSEGLAQREHFEGITFGLELTEQLLDTFWDTLFPTLEDGLDERAARLSWLKTTLTDIA
GGLPITQGQHFGVLRYDESRHVENLALQNPKAMQTALNEGKINAEIFQRSVALSDTDHLRAKALQIGTSL
NACKRLQASADRLFGHEAPSFASLADMLSRASQLAEKLLKDRGVELHPAAVAVAEPEAIFVSTDAAGEPM
NTPVQASAPAPMRTTPLTRDEAFTMLAGIAQFFKQSEPQSPVPYLIERAIKWGNMPLEGWLSDVIKDSNV
VDNIRDVLGTREPRS
 
Nucleotide Sequence: 1098 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3119309-3120406 Pseudomonas putida GB-1 chromosome, complete genome
ATGCCTGAAATCCTCAATGACCTCTCGCTGGCCACACTGGCCGCACCCATCGAAGGTGGCAGTGGCGAAG
ACTTGAGCTTCTCTGCCTTGTTCGACCAGATCAAGGAAGCCCGCCGGGCGGACCCTGACTACCTGACCCA
GGGCGACTGGCAAACCGACTTGAAGACTGCCGACTGGGAGCAGGTAATCAACCTGTCGGCTCAAGGGTTG
GCGCAGCAAAGCAAAGACTTGATGCTGGTGGCCTGGCTCAGCGAGGGCCTGGCCCAGCGTGAGCACTTCG
AAGGCATCACTTTTGGCCTAGAGCTGACCGAACAGCTTCTGGATACCTTCTGGGACACCCTGTTCCCAAC
GCTTGAAGACGGCCTGGACGAGCGCGCGGCGCGGCTGTCCTGGCTGAAGACCACGCTCACCGACATTGCC
GGTGGCTTGCCCATTACCCAAGGGCAGCATTTTGGCGTGTTGCGCTATGACGAGTCACGCCACGTCGAAA
ACCTCGCCCTGCAGAACCCCAAGGCAATGCAGACAGCACTGAACGAAGGCAAGATCAACGCCGAGATTTT
CCAGCGCTCGGTAGCGCTGAGCGACACTGATCACCTGCGTGCCAAGGCGCTGCAGATCGGCACCAGCCTG
AATGCGTGCAAACGCCTGCAGGCCAGCGCCGACCGCCTGTTCGGCCACGAGGCGCCCAGCTTCGCCAGCC
TTGCCGACATGCTGTCGCGCGCCAGCCAGCTGGCGGAGAAACTGCTCAAGGATCGCGGCGTCGAGCTGCA
CCCCGCAGCGGTGGCGGTAGCAGAACCCGAGGCCATCTTTGTCTCTACTGACGCAGCAGGTGAACCGATG
AACACGCCCGTCCAGGCCTCTGCGCCTGCCCCTATGCGCACGACACCACTGACCCGCGACGAGGCTTTCA
CCATGCTTGCGGGCATCGCCCAGTTTTTCAAGCAAAGCGAGCCGCAGAGCCCGGTACCTTACTTGATCGA
ACGTGCGATCAAGTGGGGCAACATGCCGTTGGAGGGCTGGCTGAGCGATGTGATCAAAGACAGCAACGTG
GTGGACAACATTCGTGATGTGCTAGGCACTCGCGAACCAAGGTCCTGA