SecReT6
Protein ID: 167034219
SecReT6 ID253
T6SS typei1
Gene symbol-
Locus tagPputGB1_3222
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3610137..3611600 [-]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDB0KHN2
KEGG IDppg:PputGB1_3222
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.10E-19, Aligned region: 54..114
Protein Sequence: 487 a.a.     [Download]
>gi|167034219|ref|YP_001669450.1| unnamed protein product [Pseudomonas putida GB-1]
MPVVAQVSEREITRLLAPIDPAVPAGLFDVEDETYQAIDQEMVKLGGLQDASIDWAYIEEASRQYLSQQC
KHLRIVAHLSAAWLRGGCWERWGFTLALLAGMIECYWEHAHPKPGPKGFLVKRKLVGLMINRLAEALPRL
DRFTYTPTHAAAAQAALKRLQQQDAVQLEGAALGELERLLRKHTELANGVGEAAAPEAPAASVKPAPLTD
VIAAPMPRVTMGNERETRRAVLAMAELINQQDPYDPTGYQLRRFGLWGHIQAAPQATQGNRTELMSVPLD
ITRVYEEAIASTAIDPALLQRIEKSVTACPFWVRGSFLAATVALRLAMGEVAEAIRSATARFVQRMPALQ
QLCFSDGMVFVDDQSLAWLKGTQGPSAQGSTPQEFGGLREELISQLETAGVEAVLLRLQALQADFRAPRE
RCHTTVIAADLLAARGVSWLAQDLCASVARTMQKTTASAWEPAVFQRLQQYAGSPALADQNKEQEPR
 
Nucleotide Sequence: 1464 bp     [Download]
>gi|167031021|ref|NC_010322.1|:c3611600-3610137 Pseudomonas putida GB-1 chromosome, complete genome
ATGCCGGTGGTAGCGCAAGTATCGGAGCGCGAGATCACTCGCTTGCTAGCGCCGATTGATCCGGCCGTCC
CGGCTGGTTTGTTCGATGTCGAGGACGAAACCTACCAGGCTATCGACCAGGAGATGGTCAAGCTGGGTGG
GCTACAGGACGCCTCCATCGACTGGGCTTACATCGAAGAGGCGTCGCGTCAGTACCTGAGCCAGCAATGC
AAGCACTTGCGAATCGTCGCACACCTGAGTGCTGCATGGCTGCGTGGCGGATGTTGGGAGCGCTGGGGTT
TCACCTTGGCGTTGCTGGCCGGCATGATCGAGTGTTACTGGGAGCACGCTCACCCCAAGCCAGGGCCAAA
GGGTTTTCTGGTCAAGCGCAAGCTGGTTGGTCTGATGATCAATCGCTTGGCCGAGGCGCTACCGCGTCTT
GATCGCTTTACCTACACACCGACTCATGCGGCGGCAGCGCAGGCTGCGTTGAAACGCCTGCAACAACAGG
ATGCGGTTCAGCTGGAGGGAGCCGCTCTGGGCGAACTTGAGCGCCTGCTACGCAAGCACACGGAACTTGC
CAATGGCGTCGGCGAGGCTGCCGCGCCCGAGGCGCCGGCTGCAAGCGTAAAGCCGGCGCCACTGACCGAT
GTCATCGCAGCGCCAATGCCGCGCGTGACGATGGGTAATGAGCGTGAGACACGACGGGCAGTGCTGGCTA
TGGCCGAGCTCATCAACCAGCAGGACCCTTACGACCCTACCGGGTACCAGCTACGGCGTTTCGGATTGTG
GGGGCACATTCAGGCGGCCCCTCAAGCCACTCAGGGCAACCGCACGGAATTGATGTCGGTTCCGCTGGAT
ATCACGCGGGTCTATGAAGAAGCGATTGCCAGCACAGCGATCGACCCCGCATTACTTCAGCGCATTGAAA
AGAGCGTGACGGCGTGCCCGTTCTGGGTTCGTGGCAGCTTTCTAGCTGCGACGGTCGCCTTGCGGCTGGC
GATGGGTGAAGTGGCCGAAGCCATCCGTAGCGCCACTGCTCGTTTTGTGCAGCGCATGCCCGCGCTGCAG
CAACTGTGCTTCAGCGACGGCATGGTGTTTGTCGACGACCAAAGCCTGGCCTGGCTCAAGGGCACGCAAG
GGCCTTCTGCCCAAGGATCAACCCCACAAGAGTTTGGCGGCCTGCGCGAGGAACTGATCAGTCAGCTGGA
AACCGCTGGCGTAGAAGCGGTGCTGCTAAGGCTACAAGCGCTGCAAGCGGACTTCCGAGCTCCCCGTGAG
CGCTGCCACACCACAGTGATCGCTGCCGATTTACTGGCCGCGCGGGGCGTGTCCTGGCTGGCCCAGGACT
TGTGCGCCAGCGTTGCCAGAACGATGCAGAAAACCACTGCCAGTGCGTGGGAACCGGCGGTTTTCCAGCG
CCTTCAGCAGTACGCGGGATCCCCTGCGCTGGCTGATCAAAACAAGGAACAGGAGCCTCGATGA