SecReT6
Protein ID: 167034221
SecReT6 ID253
T6SS typei1
Gene symbol-
Locus tagPputGB1_3224
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3612561..3613064 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDB0KHN4
KEGG IDppg:PputGB1_3224
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.00E-53, Aligned region: 6..158
Protein Sequence: 167 a.a.     [Download]
>gi|167034221|ref|YP_001669452.1| unnamed protein product [Pseudomonas putida GB-1]
MSRSTGSVAPKERVNIKYVPATSDMQAEVELPHKMLVLGDFGLNDNRALEDRQAMRIDKHTFNSVLSDAN
VSLDVSVPSMLGTTPDADLGVHLQFKSINDFGPDQIARQVPELNKLLELREALVALKGPLGNVPVFRKQL
QHLLNNEQARKQLAQELNLVLEAPEND
 
Nucleotide Sequence: 504 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3612561-3613064 Pseudomonas putida GB-1 chromosome, complete genome
ATGTCTAGAAGCACGGGATCTGTCGCACCAAAAGAGCGCGTCAATATCAAGTATGTCCCCGCCACGAGCG
ATATGCAGGCTGAGGTGGAGTTACCTCACAAAATGCTGGTTCTGGGAGACTTCGGCCTGAATGACAACCG
TGCGCTTGAGGACCGTCAGGCCATGCGCATCGATAAACACACATTCAACAGCGTGTTGAGCGACGCCAAC
GTGAGCCTGGACGTGTCTGTGCCGTCCATGCTCGGCACAACCCCGGACGCCGACCTGGGGGTTCACCTGC
AATTCAAGTCCATCAACGATTTCGGGCCGGACCAAATCGCACGCCAGGTACCCGAGCTGAACAAGCTGCT
GGAACTGCGTGAAGCGCTGGTCGCCCTGAAGGGCCCATTGGGCAACGTCCCCGTTTTTCGCAAGCAATTG
CAGCACCTGCTGAACAACGAGCAGGCACGTAAACAGCTTGCCCAAGAACTGAACCTGGTACTTGAAGCAC
CAGAAAATGACTGA