SecReT6
Protein ID: 167034222
SecReT6 ID253
T6SS typei1
Gene symbol-
Locus tagPputGB1_3225
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3613082..3614572 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB0KHN5
KEGG IDppg:PputGB1_3225
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.60E-184, Aligned region: 69..494
Protein Sequence: 496 a.a.     [Download]
>gi|167034222|ref|YP_001669453.1| unnamed protein product [Pseudomonas putida GB-1]
MPKPSNTNISEDTTTGTISNATLLDQIMAETKLIPTHEGYQVARHGVSAFIAEILKSNDPDQLINKHRVD
QMIAEVDRVLGKQMDAILHHPEFQQLESSWRGLKILVDRTDFRENIKLEVLHANKEDLLDDFENAADITC
SGIYKHVYTAGYGQFGGEPIAAMVGNYSFGPSSPDIKLLSYMASVGAMSHAPFLAAPSPEFFNLSSFEEL
PNLKEIKDLFAGPRHAKWRAFRESEDARHVALTGPRFMLRSAYHPQEKPIESFNYHENIAGQHDNYLWGN
STFLLASCINDSFARYRWCPNIIGPQSGGAVEDLPVHLYESLGQLQAKIPTEVLISDRKEFELAEEGFIA
LTMRKDSDNAAFFSANSVQKPKNFPKTPEGLQAQTNYKLGTQLPYLFIVNRLAHYIKVLQREQIGSWKER
RDLESELNKWIKQYVADQENPSADVRSRRPLRAAKVEVSDVAGDPGWYQVSLAVRPHFKYMGANFEISLV
GRLDTQ
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3613082-3614572 Pseudomonas putida GB-1 chromosome, complete genome
ATGCCTAAGCCTAGCAATACCAACATCAGCGAAGACACAACGACCGGCACGATAAGCAATGCCACCTTGC
TCGACCAGATCATGGCAGAAACCAAACTAATACCCACGCATGAGGGCTATCAGGTTGCCCGGCATGGCGT
ATCTGCCTTCATCGCCGAAATCCTCAAAAGCAATGACCCGGATCAGTTGATCAACAAGCACCGGGTCGAC
CAGATGATTGCAGAGGTTGACCGGGTACTCGGCAAACAGATGGATGCCATTCTGCATCATCCAGAGTTCC
AGCAGCTTGAATCTTCATGGCGCGGCCTGAAAATCCTGGTAGACCGCACCGACTTCAGGGAGAACATCAA
GCTCGAAGTGCTGCATGCGAACAAAGAAGACCTGCTCGATGACTTCGAAAATGCTGCAGACATTACCTGC
AGCGGCATTTACAAACATGTTTATACCGCAGGTTACGGTCAATTCGGGGGCGAGCCGATTGCGGCCATGG
TTGGTAACTACAGCTTCGGCCCCTCTTCGCCGGATATCAAACTGCTGAGTTACATGGCCTCCGTAGGCGC
CATGTCTCACGCACCTTTCCTGGCCGCGCCTTCTCCTGAGTTCTTCAACTTGAGCAGCTTCGAAGAACTG
CCCAATCTCAAGGAAATAAAAGACCTCTTCGCCGGCCCTCGGCACGCCAAATGGCGCGCATTCCGTGAAA
GCGAAGACGCCCGTCATGTCGCTTTGACCGGGCCGCGTTTCATGCTCCGCTCCGCCTACCACCCGCAGGA
AAAACCGATCGAGAGCTTCAATTATCACGAAAACATCGCCGGGCAGCATGACAACTACCTGTGGGGCAAC
TCCACCTTCCTGCTGGCCAGTTGCATCAATGACAGCTTCGCCCGCTACCGCTGGTGTCCGAACATCATCG
GTCCGCAATCGGGCGGCGCCGTCGAAGACCTGCCAGTCCATCTGTACGAGTCCTTGGGCCAGTTGCAGGC
CAAGATTCCTACCGAGGTTCTGATCTCCGACCGCAAAGAATTCGAACTGGCGGAAGAGGGTTTCATCGCC
CTGACCATGCGCAAAGACAGCGACAACGCCGCGTTCTTTTCGGCCAACTCGGTGCAGAAACCCAAGAACT
TCCCGAAAACCCCCGAGGGGCTACAGGCACAGACCAATTACAAACTGGGTACCCAGTTGCCCTACCTGTT
CATCGTCAACCGGCTGGCTCACTACATCAAGGTGCTACAGCGCGAACAGATTGGCAGTTGGAAAGAGCGC
CGCGACCTTGAGTCCGAGCTTAACAAGTGGATCAAGCAGTACGTCGCGGACCAGGAGAACCCGTCTGCCG
ATGTTCGCAGTCGCCGGCCGCTTCGTGCCGCCAAGGTCGAGGTATCGGATGTTGCCGGTGACCCAGGCTG
GTACCAGGTTTCGCTCGCTGTTCGCCCACACTTCAAGTACATGGGCGCGAATTTCGAAATTTCCCTGGTC
GGACGGCTCGATACGCAATGA