SecReT6
Protein ID: 167034223
SecReT6 ID253
T6SS typei1
Gene symbol-
Locus tagPputGB1_3226
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3614569..3614979 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB0KHN6
KEGG IDppg:PputGB1_3226
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-20, Aligned region: 25..119
XLF [PF09302], Evalue: 0.0033, Aligned region: 6..89
Protein Sequence: 136 a.a.     [Download]
>gi|167034223|ref|YP_001669454.1| unnamed protein product [Pseudomonas putida GB-1]
MSGLFDRLKLDQCISRKASRRESASHKFAAIKRHLETLLNARQGCSQSSPELGLRDFNGHDANNGDLLVQ
VSADIRRTLQRFEPRIRVRTLKAVPDAHTPLELHFKLDCLVRVNNHTEQLQLELLVNGHNRYTRVR
 
Nucleotide Sequence: 411 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3614569-3614979 Pseudomonas putida GB-1 chromosome, complete genome
ATGAGTGGGCTTTTTGATCGCTTGAAGCTGGATCAGTGCATCAGCCGGAAGGCCTCCCGGCGGGAGAGCG
CTTCCCACAAATTCGCCGCCATCAAGCGCCACCTCGAAACGCTGCTCAATGCCCGCCAGGGGTGCTCACA
GAGCAGCCCTGAGCTAGGCCTGCGCGACTTCAACGGGCATGACGCAAACAACGGCGACTTGCTCGTACAG
GTGAGCGCGGATATCCGCCGCACGCTCCAGCGATTCGAGCCACGCATACGAGTGCGCACGCTAAAAGCAG
TGCCTGATGCCCATACCCCGCTAGAGCTGCATTTCAAGCTGGACTGTCTGGTACGGGTCAACAACCACAC
TGAGCAGCTGCAACTTGAGCTGCTGGTCAACGGGCACAACCGCTACACCCGAGTGAGGTGA