SecReT6
Protein ID: 167034224
SecReT6 ID253
T6SS typei1
Gene symbol-
Locus tagPputGB1_3227
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3614983..3616749 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDB0KHN7
KEGG IDppg:PputGB1_3227
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.50E-190, Aligned region: 4..588
Protein Sequence: 588 a.a.     [Download]
>gi|167034224|ref|YP_001669455.1| unnamed protein product [Pseudomonas putida GB-1]
MSLKDSFSEELRYLHELGNDFAKDNPQLARLLGNGASDPDVERLMEAFAFLTAKLRLKLEDDLPELTHPM
LQLLWPNYLRPLPSATIIQFSPIKQSLSQSQRIPKGSRLFSKPVDGVACEFRTCTAVNVHPFEIDTVAAT
QTLDSSVVSIGLQILVERPLNSLGCTSIDFYLSGDTRTARTLYLWISQYLKHVSVAIDGEARRLPANSIT
FPGFSPDDAMLPYPQNVFDGYRILQEYFAFPQRFHFFSVTGLEKIWPAHDSARICLEFHFTRQLPDSLRV
GRADFNLFCAPAVNLFQHSAEPIDLSGEDALVPLKPKGTEPHGYEIFSVDQVISTRTTTDGKIGEHLRTF
RPFESFAHEIEHIQGRTALYYRYQLEECLHGDGVMHRIAFVRADANSYIGELETASIDLTCTNRDLPLAL
GIDDINVLTELTPPLATYTNLCKPTRPCRPVLDGQLQWALISNMSLNYLSLLSVEPLKAVIRAYDFMALH
DIQQARTTRKRLEGMRDIHTQPMDWLIKGQPIRGLHTRLKLDQTAFLCEGDLYLFSCVLAHFFALYASIN
SFHQLEVINTTNNEHYTWPIQTGKQPLI
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3614983-3616749 Pseudomonas putida GB-1 chromosome, complete genome
ATGTCACTGAAAGACAGTTTCAGCGAAGAACTGCGTTACCTGCACGAACTCGGGAACGACTTCGCCAAAG
ACAACCCACAACTCGCCCGGTTGCTTGGCAACGGTGCCAGCGACCCCGATGTCGAACGCCTGATGGAAGC
CTTCGCATTCCTGACCGCCAAGCTTCGGCTCAAGCTGGAAGACGACCTGCCAGAGCTGACCCATCCCATG
CTGCAGTTGCTGTGGCCGAATTATCTGCGCCCCCTCCCCAGCGCAACGATCATCCAGTTCAGCCCGATCA
AGCAATCCCTCAGCCAGTCACAACGCATCCCAAAGGGGTCGAGGCTGTTCTCGAAACCGGTAGACGGCGT
GGCCTGTGAGTTTCGCACCTGCACAGCGGTCAACGTTCATCCATTCGAGATCGACACGGTGGCCGCAACC
CAGACACTTGACAGTTCTGTGGTCAGTATCGGCCTTCAAATACTGGTCGAGCGGCCGTTGAACAGTTTGG
GCTGTACCAGCATCGACTTTTACCTCTCCGGCGATACCCGCACGGCACGCACGCTTTACCTGTGGATTTC
TCAATACCTCAAGCATGTCAGCGTGGCCATCGATGGCGAGGCACGTCGTCTGCCGGCAAACAGCATTACG
TTCCCAGGGTTCAGCCCCGATGACGCCATGCTGCCTTACCCACAAAACGTCTTTGATGGTTACCGGATCC
TGCAGGAGTACTTCGCTTTCCCCCAGCGCTTCCACTTCTTCAGTGTGACTGGGCTGGAGAAAATCTGGCC
AGCTCATGACAGCGCGCGCATATGCCTAGAGTTTCACTTCACGCGCCAGCTACCCGACTCGTTGCGTGTC
GGCAGAGCAGATTTCAACCTGTTCTGCGCACCTGCGGTGAACCTGTTCCAGCACAGCGCCGAACCTATCG
ATCTGTCCGGCGAGGACGCCTTGGTTCCACTGAAGCCCAAGGGCACAGAGCCGCACGGATACGAAATCTT
CAGTGTCGACCAGGTCATTAGCACCCGAACGACAACAGACGGAAAAATCGGTGAACACCTACGTACCTTC
CGTCCCTTCGAGTCGTTTGCCCATGAAATCGAGCATATTCAGGGGCGCACGGCGCTGTACTACCGCTACC
AGCTGGAAGAGTGCCTGCACGGCGATGGCGTCATGCATCGAATCGCCTTCGTCCGTGCCGACGCCAATAG
CTACATAGGCGAGCTGGAAACCGCGTCCATCGACCTGACCTGCACTAATCGGGACCTACCGCTGGCGCTG
GGCATCGATGACATCAACGTCCTGACCGAACTCACGCCCCCGCTGGCCACCTACACCAACCTCTGTAAAC
CCACCCGTCCCTGCCGCCCGGTGCTGGACGGCCAGTTGCAATGGGCATTGATTTCAAACATGTCGCTCAA
CTACCTCTCCCTGCTCTCGGTAGAGCCGCTTAAAGCAGTGATACGAGCCTATGACTTCATGGCCCTACAC
GACATCCAGCAGGCCCGCACCACCCGTAAACGCCTGGAAGGTATGCGCGATATTCATACACAACCCATGG
ATTGGCTAATAAAGGGACAACCTATTCGTGGTCTGCACACCCGGCTGAAACTGGACCAGACCGCCTTCCT
TTGCGAAGGCGACTTGTACTTGTTCAGTTGTGTGCTCGCCCACTTCTTCGCCCTGTACGCCAGCATCAAC
TCCTTCCACCAGTTGGAAGTGATCAACACCACCAATAATGAGCACTACACATGGCCAATACAGACCGGCA
AGCAACCGCTGATCTAG