SecReT6
Protein ID: 167034225
SecReT6 ID253
T6SS typei1
Gene symbol-
Locus tagPputGB1_3228
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3616713..3617729 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDB0KHN8
KEGG IDppg:PputGB1_3228
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-84, Aligned region: 18..321
Protein Sequence: 338 a.a.     [Download]
>gi|167034225|ref|YP_001669456.1| unnamed protein product [Pseudomonas putida GB-1]
MANTDRQATADLADKLLSEAHQYNFFQLLERLHGLHGDDLEPRWPDEATRLRVRLACDPRLTFPVSDVYN
AQRMHTEEERYRVVATFMGLHGTDSPLPTYYLEQVAYEHAQGIGVRPAFFDFFNHYLLSLLHRIWRKYRY
YIRFQPGASDGFSQYVFALLGLNDKQLRGDTALPWSRLLSFAGVIASRSRAPGTVAGIIGHCFDLKHVQI
REFETRSVPTAARQLVSLGRSNGQLGSTFMVGSRTRTRSSKFTIVISELDQAQMRDLLPSGINFGRLRAL
IGFLLRDGLAYDLELRLKQNALSPFCLHRSQGAYLGWTSFFDDQHGQLSPVVQFRGRS
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3616713-3617729 Pseudomonas putida GB-1 chromosome, complete genome
ATGGCCAATACAGACCGGCAAGCAACCGCTGATCTAGCCGACAAGCTGCTCTCGGAAGCGCACCAGTACA
ACTTCTTTCAGTTGCTGGAACGGCTGCATGGCTTGCATGGCGATGATCTGGAACCCCGTTGGCCGGATGA
AGCAACCCGGCTGCGTGTGCGCCTGGCCTGCGACCCCCGGCTGACCTTCCCCGTTTCGGACGTGTACAAC
GCCCAGCGGATGCACACTGAGGAGGAGCGCTACCGAGTCGTTGCCACGTTCATGGGTTTGCACGGTACTG
ATTCACCGCTGCCCACCTATTACCTGGAACAAGTGGCCTATGAACATGCACAGGGCATTGGTGTGCGACC
GGCCTTCTTCGACTTTTTCAACCACTACCTGCTCAGCCTGTTACACCGGATCTGGCGCAAGTACCGCTAC
TACATCCGTTTCCAGCCAGGTGCCAGTGACGGGTTTTCGCAATACGTGTTTGCCCTGCTGGGGCTTAATG
ACAAACAGCTGCGAGGGGACACGGCACTCCCGTGGAGCCGGCTGCTCAGCTTTGCTGGCGTTATCGCCAG
CCGCAGCCGTGCGCCGGGCACCGTGGCCGGCATCATAGGACACTGCTTCGACCTCAAACACGTACAGATT
CGCGAGTTCGAAACGCGTTCGGTACCCACAGCGGCCAGACAGCTTGTAAGCCTGGGCCGCTCTAACGGCC
AGCTGGGCAGCACGTTCATGGTCGGCAGCCGCACCCGCACCCGCAGCAGCAAGTTCACCATCGTGATCAG
CGAACTCGACCAAGCGCAGATGCGGGACTTGCTGCCCAGCGGCATCAACTTCGGCCGTTTGCGTGCACTG
ATCGGCTTTCTGCTGCGTGACGGGCTGGCCTACGACCTGGAACTGCGCCTGAAGCAGAACGCATTGTCGC
CTTTCTGCCTGCACCGCAGCCAGGGCGCCTACCTGGGCTGGACCAGCTTCTTCGATGACCAGCATGGCCA
GCTCAGCCCTGTCGTGCAGTTCAGGGGGCGTTCTTGA