SecReT6
Protein ID: 167034226
SecReT6 ID253
T6SS typei1
Gene symbol-
Locus tagPputGB1_3229
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3617726..3618295 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDB0KHN9
KEGG IDppg:PputGB1_3229
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 4.80E-07, Aligned region: 30..96
Protein Sequence: 189 a.a.     [Download]
>gi|167034226|ref|YP_001669457.1| unnamed protein product [Pseudomonas putida GB-1]
MSTLTLSIINLGQLRHDMTARHRFDCKGGTIGSRRANWRLNDRDQAVAPIHCEIRWIEGSFCVIDHCHRT
YMNDSSVCLGSLPPRRLMEGDQLRIGAYRLQVQYAQDPACTHALEDLFNPDRRVLDRLVAEAPISPWQAK
PTPSQPVAEICSVFGTDMGNDPLAALEAVACVATSPENPLQRLIAGERP
 
Nucleotide Sequence: 570 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3617726-3618295 Pseudomonas putida GB-1 chromosome, complete genome
TTGAGCACTTTGACCTTGAGCATCATCAACCTCGGCCAACTGCGGCATGACATGACAGCGCGGCATCGGT
TCGATTGCAAAGGCGGGACCATCGGAAGCAGGCGGGCTAACTGGCGGCTCAATGACCGTGATCAGGCCGT
GGCGCCTATCCACTGCGAAATCCGCTGGATTGAAGGCAGCTTCTGCGTGATCGATCACTGCCACCGCACC
TATATGAATGACAGCTCCGTCTGCCTGGGATCACTCCCTCCCAGGCGCCTGATGGAAGGGGACCAACTTC
GCATTGGTGCTTATCGACTACAGGTGCAGTACGCCCAGGATCCAGCATGCACGCATGCCCTGGAGGACCT
GTTCAACCCAGATCGCAGGGTACTCGACCGCTTGGTAGCCGAAGCCCCTATCAGCCCATGGCAGGCCAAA
CCTACTCCCAGCCAACCTGTCGCCGAGATCTGCTCGGTCTTTGGGACTGACATGGGAAATGATCCCCTGG
CGGCGCTGGAGGCAGTGGCCTGCGTAGCAACATCGCCAGAAAACCCACTGCAACGCCTGATTGCAGGAGA
ACGTCCATGA