SecReT6
Protein ID: 167034227
SecReT6 ID253
T6SS typei1
Gene symbol-
Locus tagPputGB1_3230
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3618292..3619089 [+]
Producthypothetical protein
NoteTssJ
UniProt IDB0KHP0
KEGG IDppg:PputGB1_3230
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.30E-24, Aligned region: 16..69
T6SS-SciN [PF12790], Evalue: 6.30E-24, Aligned region: 152..256
Protein Sequence: 265 a.a.     [Download]
>gi|167034227|ref|YP_001669458.1| unnamed protein product [Pseudomonas putida GB-1]
MTSHPLLFAPLLIALVGLAGCTSLSRVSQVVMDPSLPIGPPKDHPTQLAFSINASPTLNGNPNSLDVAVE
QDTALEPSPYAVTLSADDPYALTEKIGTLFEYLQAQFPAISPVEMDEENDSPQARSPLEESAPGSYDDPT
VVLTLPRSAAAASEQVATPMAIKILQLRDDSLLRNTVYQLLDQDPAAALRSTYIRADDYLLSPGQFKYIP
FEAIHAETRFVAVIGDYRGHENASWRQVLRIPPRGHQIVLSVLVNDTHIVLKEED
 
Nucleotide Sequence: 798 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3618292-3619089 Pseudomonas putida GB-1 chromosome, complete genome
ATGACGAGTCATCCATTGCTGTTCGCGCCTCTGCTGATTGCGCTGGTGGGGTTGGCCGGCTGCACGTCTC
TAAGCAGAGTGAGTCAAGTGGTCATGGACCCTTCTCTACCCATCGGGCCGCCCAAGGACCACCCAACCCA
GCTCGCGTTCAGCATCAATGCCAGCCCTACCCTCAACGGTAACCCGAACAGCCTTGACGTAGCGGTCGAA
CAGGATACCGCCTTGGAGCCCAGCCCTTACGCAGTGACCCTGAGTGCTGATGACCCCTACGCGTTGACCG
AAAAAATCGGGACTTTGTTCGAGTACCTGCAAGCACAATTCCCGGCCATATCGCCCGTCGAGATGGATGA
GGAAAACGACAGTCCCCAGGCTCGCTCCCCTCTGGAAGAAAGCGCCCCCGGCAGCTATGACGACCCAACG
GTGGTGCTGACCTTACCGCGCAGCGCAGCCGCGGCCTCGGAGCAGGTCGCCACGCCCATGGCCATCAAGA
TCCTGCAACTGCGCGACGATTCGTTGCTGCGCAACACCGTCTACCAATTGCTGGACCAGGACCCGGCCGC
AGCCCTGCGCAGTACCTACATCCGTGCTGATGACTATTTGCTGAGCCCTGGCCAGTTCAAATACATCCCG
TTCGAAGCTATCCACGCCGAAACCCGTTTCGTGGCGGTGATTGGCGACTACCGAGGCCACGAGAACGCCA
GCTGGCGGCAAGTGCTGCGTATTCCGCCGCGTGGCCACCAGATCGTGCTGTCGGTATTGGTCAACGACAC
GCACATCGTACTCAAGGAAGAAGACTGA