SecReT6
Protein ID: 167034228
SecReT6 ID253
T6SS typei1
Gene symbol-
Locus tagPputGB1_3231
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3619145..3620482 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDB0KHP1
KEGG IDppg:PputGB1_3231
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-149, Aligned region: 19..443
Protein Sequence: 445 a.a.     [Download]
>gi|167034228|ref|YP_001669459.1| unnamed protein product [Pseudomonas putida GB-1]
MSSRNPVLWPEGLFVKPQHFQQAARASEAALHQRLASLNAAFYGFSEIQLNDEYLSLGKIAITRARGVMP
DGTVFDIPADLPPPPPLEIGDDACKDSEVYLCLPLRTDGGREVSWPDNAANFRYTAQAQEIKDTHTADGD
LVNVDLAVPNLQLKRKAQDSSAYTRLALARILERRPDGSLQLDEAFYPTSVSVRAIPALQRFLDEITNTL
RERARGLATRIGASGQSGIADIRDFNLLQAMNRWWPCFQHLARQAQTHPEQLYLSMSQACGEFVTFTDEN
RLPQEYPAYHHTALHTSFKPLENTLRRSLSTVLRPRAVSLPLEGEAFGVMTTTLEDRRLIDEADFILAVR
ADLPPQALRQMFIQKAKITSLESLIDLVPLQLPGIPLRPLPVAPRDLPFHAGFSYFELDRRDPTWACMAK
ANGFGIHIAGEFPGLELQFWAIRSE
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3619145-3620482 Pseudomonas putida GB-1 chromosome, complete genome
ATGAGTTCACGCAACCCCGTCCTTTGGCCCGAAGGCCTGTTCGTAAAACCACAGCATTTCCAACAGGCGG
CCAGGGCCAGTGAAGCAGCCCTGCACCAGCGCCTCGCCAGCCTCAATGCAGCGTTCTATGGCTTCAGCGA
AATACAGTTGAACGACGAGTACCTGAGCCTTGGCAAGATAGCCATCACTCGGGCGCGAGGCGTCATGCCG
GACGGCACGGTATTCGACATTCCCGCCGACCTGCCACCACCACCGCCACTGGAAATCGGCGACGACGCTT
GCAAGGACAGCGAGGTGTATCTGTGCCTGCCGCTGCGAACCGATGGGGGGCGCGAAGTGAGCTGGCCCGA
CAATGCTGCTAACTTCCGCTATACCGCCCAGGCACAGGAAATCAAGGATACCCACACCGCCGATGGCGAC
CTGGTAAACGTAGACCTTGCCGTGCCCAACCTGCAGCTCAAGCGCAAGGCCCAGGACAGTAGCGCCTACA
CTCGCCTGGCACTGGCACGCATCCTGGAACGGCGCCCCGATGGCAGCCTGCAGCTGGACGAAGCGTTCTA
CCCTACCAGCGTGTCAGTGCGGGCGATACCAGCACTGCAGCGGTTCCTGGACGAAATCACCAACACACTG
CGCGAGCGCGCGCGGGGACTTGCCACACGCATTGGCGCATCGGGCCAATCCGGTATCGCCGATATCCGCG
ACTTCAACCTGCTGCAGGCCATGAACCGTTGGTGGCCATGCTTTCAGCACCTGGCCAGGCAAGCGCAAAC
GCACCCCGAGCAGCTGTACCTGAGCATGAGCCAGGCCTGCGGCGAATTCGTCACTTTCACCGACGAAAAC
AGACTGCCGCAGGAGTACCCGGCGTATCACCACACTGCACTGCACACCTCTTTCAAACCGCTGGAAAACA
CCTTGCGCCGATCCCTGAGCACGGTCCTGCGGCCACGCGCCGTGTCGCTACCGTTGGAGGGCGAAGCATT
CGGCGTGATGACAACCACGCTAGAGGACCGTCGCCTAATCGACGAAGCCGACTTCATCCTCGCCGTGCGC
GCCGACCTGCCGCCACAGGCTTTGCGCCAGATGTTCATCCAGAAAGCCAAGATTACTTCACTTGAGTCAT
TGATCGACCTGGTGCCGCTACAACTGCCGGGCATCCCTTTGCGACCACTGCCGGTGGCCCCGCGTGACCT
GCCCTTCCATGCAGGTTTCAGCTACTTCGAGTTGGACCGGCGTGACCCGACCTGGGCATGCATGGCCAAG
GCAAATGGCTTCGGTATCCACATCGCGGGCGAGTTCCCAGGACTTGAGCTGCAGTTCTGGGCGATCAGGA
GTGAGTGA