SecReT6
Protein ID: 167034229
SecReT6 ID253
T6SS typei1
Gene symbol-
Locus tagPputGB1_3232
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3620484..3621353 [+]
Producthypothetical protein
NoteTssL
UniProt IDB0KHP2
KEGG IDppg:PputGB1_3232
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.10E-65, Aligned region: 67..272
Protein Sequence: 289 a.a.     [Download]
>gi|167034229|ref|YP_001669460.1| unnamed protein product [Pseudomonas putida GB-1]
MGGQNNTPTGEKSTEGSQLTSALKQPMADAQVKPPHAQAPMEKPEPEPITEGYPADPEFQLRGGFANLML
DAASPLFGLVIRLRTLDELPNIKEVHQQVRNQIDNIQEEIRQHGYEPAQLLAYSYGLCLFIDEAVMERPW
GKSSCWSQEPLLSIFHDETWGGEKIFTVISRLMQEPKRYQDVLEFMYYALCLGLRGKYALAPKGEETLNA
LIHQLHGIIRELRGPTPEEVCDPYTNVAPRNFRMDRQWPWWSPLVISAIAMAVAYGIYSYRLHLITTEVV
ESLNGILQQ
 
Nucleotide Sequence: 870 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3620484-3621353 Pseudomonas putida GB-1 chromosome, complete genome
ATGGGAGGACAGAACAACACGCCAACCGGTGAAAAAAGCACTGAAGGCAGCCAGCTCACGTCAGCACTCA
AACAGCCAATGGCAGACGCCCAGGTCAAACCACCCCATGCGCAAGCGCCCATGGAGAAACCTGAGCCTGA
ACCGATCACTGAAGGCTACCCCGCCGATCCGGAGTTTCAACTGCGAGGTGGTTTTGCCAACCTGATGCTG
GATGCCGCATCGCCGTTGTTCGGCCTGGTTATCCGCCTGCGTACGCTTGATGAATTGCCAAACATCAAAG
AAGTGCATCAACAAGTTCGCAACCAGATCGACAACATTCAGGAAGAAATACGCCAGCACGGTTACGAGCC
TGCTCAGTTATTGGCGTATTCCTATGGACTGTGCCTGTTCATAGACGAGGCCGTCATGGAACGGCCCTGG
GGTAAGAGCAGCTGCTGGAGCCAGGAGCCGCTGCTGAGCATCTTCCACGACGAAACCTGGGGTGGGGAAA
AAATCTTCACCGTGATTTCCCGTCTGATGCAGGAGCCCAAGCGTTATCAGGACGTACTGGAGTTCATGTA
CTACGCCCTGTGCCTTGGGCTCAGGGGCAAGTACGCCCTCGCGCCCAAGGGCGAAGAAACACTCAACGCA
CTGATTCACCAACTGCACGGGATCATTCGCGAACTACGCGGCCCCACGCCAGAAGAAGTCTGCGACCCCT
ACACCAACGTGGCCCCACGAAATTTCCGCATGGACCGGCAGTGGCCCTGGTGGAGCCCCCTGGTGATTTC
GGCCATCGCAATGGCTGTGGCCTACGGCATCTACAGCTATCGCCTGCACCTGATTACCACCGAGGTAGTG
GAGTCGCTCAACGGCATCTTGCAGCAGTAG