SecReT6
Protein ID: 167034231
SecReT6 ID253
T6SS typei1
Gene symbol-
Locus tagPputGB1_3234
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3622062..3624230 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB0KHP4
KEGG IDppg:PputGB1_3234
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-54, Aligned region: 29..349
Phage_base_V [PF04717], Evalue: 1.30E-19, Aligned region: 391..484
Gp5_C [PF06715], Evalue: 2.80E-07, Aligned region: 525..547
Gp5_C [PF06715], Evalue: 2.80E-07, Aligned region: 532..555
Gp5_C [PF06715], Evalue: 2.80E-07, Aligned region: 549..571
Gp5_C [PF06715], Evalue: 2.80E-07, Aligned region: 564..586
Gp5_C [PF06715], Evalue: 2.80E-07, Aligned region: 581..595
Gp5_C [PF06715], Evalue: 2.80E-07, Aligned region: 605..619
PRELI [PF04707], Evalue: 0.0016, Aligned region: 103..182
Protein Sequence: 722 a.a.     [Download]
>gi|167034231|ref|YP_001669462.1| unnamed protein product [Pseudomonas putida GB-1]
MPSRSSLRYSFQPQVGNAEFEVVSFKLKEELSQPFTLTLELISFEHDVDFGHLLDKPALFTIWDGAHPVR
YVHGLISSFSQGESGFSRTYYHALVEPQLARARLRSNWRIFQHKTVPQILELMLKRQGIVQFDMRTSMDH
QVREFCVQAGETDLDFIARLAAEEGIVYRFEHNDERHGLIITDRLQSLGLISHGAIKREDNDEGFDEDDA
PLAPDTVLYLSSSGGDQPKSCLRRLRYSEQVRTARQVQRDYTFTHPAYRQEHRASGRYLEHQSKDYECFD
YPGRYKRDAVGKPFTENRITALRHDARVAEVEGDDVRLQPGLSFNLTGHPRENLNVHWRVSAVSHEGSQF
TSLQEEAFGAEQSTRYEQKAVLVPGRIEWRPAPLSKPRVDGPHMATVVGPQGEEIYCDQWGRVKVSFPWD
RESENNEFSSCWVRVSQGWAGGSWGAMAIPRIGQDVIIHYVNGDPDQPMITGRTYCGNQLPPYDLPQHKT
RMTIKSQTHKGDGFNELRFEDELGQEEVFIHAQKDHNIVVKHDESTQVGNDRTEQVNNDESILIGHDRTE
TVGNDEHVTIGQDAALDIGRNQTIKIAKDRVETIGNHRHDHIAANHHITIGGNLKQQIEGLAELEARGAI
HRRTRRYELRTAEAVIIQGPGGSIQIDETGITLNSPTIRINGQILKSPDGATNPFSISSAPVTGKPLERQ
CGRRPDGVCPLPDCRCIGGAGR
 
Nucleotide Sequence: 2169 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3622062-3624230 Pseudomonas putida GB-1 chromosome, complete genome
ATGCCCAGCCGATCTAGTTTGCGATACAGCTTCCAGCCCCAGGTGGGAAACGCTGAATTCGAAGTGGTGT
CGTTCAAGCTCAAGGAGGAGCTCAGCCAACCGTTCACATTAACCCTGGAGCTGATCAGCTTTGAGCACGA
TGTCGACTTTGGCCACTTGCTCGACAAACCAGCGCTGTTCACCATCTGGGACGGTGCCCACCCCGTACGT
TACGTACACGGCCTAATCAGCAGCTTCAGCCAGGGCGAGAGTGGTTTCTCCCGCACTTACTACCATGCCT
TGGTCGAACCCCAATTGGCCCGTGCCAGGCTTCGCTCGAACTGGCGCATCTTCCAGCACAAGACCGTTCC
GCAAATTCTCGAGCTCATGCTCAAGCGCCAAGGCATCGTCCAGTTCGACATGCGCACTAGCATGGACCAT
CAGGTACGCGAGTTCTGCGTACAGGCCGGCGAGACCGACCTCGACTTCATCGCCCGCCTGGCAGCAGAGG
AAGGCATCGTCTACCGCTTCGAGCACAACGATGAACGCCATGGATTGATCATCACCGACAGGCTGCAATC
ACTTGGCCTGATCAGTCATGGTGCCATCAAGCGCGAGGACAACGACGAAGGCTTCGACGAAGACGACGCG
CCCTTGGCCCCCGACACCGTGCTGTACCTTTCCAGCAGCGGCGGTGACCAGCCTAAATCCTGCCTGCGGC
GCCTGCGCTACAGCGAACAGGTACGTACCGCACGACAAGTCCAGCGCGACTACACCTTCACCCACCCGGC
CTATCGCCAGGAGCACAGGGCGTCCGGCCGTTACCTGGAGCATCAGTCCAAGGATTACGAGTGCTTCGAC
TACCCGGGCCGTTACAAACGCGACGCCGTTGGTAAACCGTTCACCGAAAATCGCATCACTGCCTTACGAC
ACGATGCGCGCGTTGCCGAGGTCGAGGGTGACGATGTACGCCTGCAACCGGGTCTGAGCTTCAACCTGAC
CGGTCACCCACGGGAAAACCTGAATGTGCATTGGCGGGTAAGCGCGGTCAGCCACGAAGGCAGCCAGTTC
ACCAGCCTGCAGGAAGAGGCGTTCGGCGCTGAGCAAAGCACACGTTACGAACAAAAAGCTGTGCTGGTTC
CGGGCCGAATCGAGTGGCGCCCTGCGCCCTTGTCCAAGCCACGGGTTGACGGCCCGCACATGGCAACCGT
GGTTGGACCACAGGGCGAGGAGATCTACTGCGACCAATGGGGCCGAGTCAAAGTCAGCTTCCCCTGGGAC
CGTGAAAGTGAAAACAATGAATTCAGCTCCTGTTGGGTGCGCGTGTCGCAGGGCTGGGCCGGTGGGAGTT
GGGGCGCCATGGCCATCCCGCGCATAGGCCAGGACGTGATCATCCACTACGTCAACGGTGACCCCGATCA
GCCGATGATCACCGGCCGCACCTACTGCGGTAACCAACTGCCTCCGTATGATCTGCCTCAGCACAAGACC
CGTATGACCATCAAGAGCCAGACCCACAAGGGCGATGGCTTCAATGAGCTGCGCTTCGAGGATGAACTGG
GCCAGGAGGAAGTGTTCATCCATGCCCAGAAAGACCACAACATCGTGGTCAAGCATGACGAAAGTACCCA
GGTCGGCAATGACCGCACGGAACAGGTCAATAACGACGAGTCGATTTTGATTGGCCATGACCGTACTGAA
ACGGTTGGCAATGACGAACACGTCACCATTGGCCAAGACGCCGCGCTCGATATAGGGCGCAACCAAACCA
TCAAGATAGCCAAGGACCGTGTTGAAACCATCGGCAATCACCGCCACGACCACATCGCCGCCAATCACCA
CATCACTATTGGAGGCAACCTCAAGCAGCAGATCGAAGGGCTCGCCGAGCTGGAAGCCCGAGGAGCAATC
CACAGGCGTACCCGCCGCTATGAGCTTCGTACGGCAGAAGCAGTGATCATCCAGGGCCCCGGGGGCTCTA
TCCAGATCGATGAGACCGGCATCACCCTGAACAGCCCGACAATACGCATCAACGGCCAAATCCTCAAATC
GCCCGATGGGGCAACCAACCCCTTTTCAATCAGCAGCGCGCCAGTCACTGGCAAACCTCTGGAACGTCAG
TGTGGGCGTCGCCCCGATGGCGTCTGTCCCTTGCCCGACTGCCGTTGCATCGGGGGGGCAGGTCGATGA