SecReT6
Protein ID: 16759251
SecReT6 ID24
T6SS typei3
Gene symbol-
Locus tagSTY0286
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T6SS(s) in this replicon]
Location [Strand]302488..303120 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ8Z981
KEGG IDsty:STY0286, stt:t2599
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 210 a.a.     [Download]
>gi|16759251|ref|NP_454868.1| hypothetical protein STY0286 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MADIRGITLSNSAALHLQVRDVERALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQV
WARETLGDLAPDFSRLRQLLALLPDVVQTTTPEIPPSPAPAPAPAGTVMDNAIPARAEDVPPVNAPPGIS
IPHNAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIPVELLEKWDALE
 
Nucleotide Sequence: 633 bp     [Download]
>gi|16758993|ref|NC_003198.1|:c303120-302488 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGGCAGACATTCGCGGTATCACGCTGTCAAACAGTGCCGCCCTGCACCTGCAGGTACGGGACGTGGAGC
GCGCGTTATCCGCCCCTCGCCCGGCTGATGCGCTGGCCCCCGAATCCGTCCGCCAGCAACTGGCAGACCT
CGAAGCCCGTGGGGCATTACCGCTAGCGGCGTTTCGCGAAGCGCAGGAAAGCGCAGAACGCCTGCAAGTG
TGGGCGCGTGAGACATTAGGCGATCTGGCTCCAGATTTTTCACGCCTGCGGCAGTTGTTAGCGCTGCTGC
CTGACGTGGTACAGACAACCACGCCGGAAATCCCTCCGTCGCCAGCGCCAGCGCCAGCTCCCGCAGGCAC
GGTTATGGATAATGCCATTCCTGCACGGGCAGAGGATGTGCCGCCTGTCAACGCGCCACCCGGTATATCT
ATCCCACACAATGCTGAACCGGGGCCAATTCGCGATCGTAATGATGCGCTGGAACGCCTGCGGTGCATTC
GTCGCTGGTTTGAGAGCAGTGAACCCAGCAGCCCGACCATCCCACTATTACGTCAGGCTGAAAGACTGGT
GGGAAAACGGTTCTCGGAGGTGATCAATGAGATCCCGGTGGAGTTGCTGGAGAAGTGGGATGCCCTGGAG
TGA