SecReT6
Protein ID: 16759252
SecReT6 ID24
T6SS typei3
Gene symbol-
Locus tagSTY0287
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T6SS(s) in this replicon]
Location [Strand]303120..303542 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ8Z980
KEGG IDstt:t2598, sty:STY0287
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.60E-19, Aligned region: 51..110
Protein Sequence: 140 a.a.     [Download]
>gi|16759252|ref|NP_454869.1| hypothetical protein STY0287 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MDMSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDARRLLTRSKDIR
VLILLLRSRIQQAGAQGLAEMLTQLAELSVIWSDALHPQLLTGEGASAESIEDAALARSNALAARWITKA
 
Nucleotide Sequence: 423 bp     [Download]
>gi|16758993|ref|NC_003198.1|:c303542-303120 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGGACATGTCCCTGACTAAACCGGTAAGCGCGGAACAACCCTGCGGCCCCGATCCGGAGTACGATCCGG
AATACCTGCTGCTGTTCAGCCGCGCCGCCCCCCAGGCGGAGGCGCAATATGGTGATTTTGTCAGTACGCC
GGAAGCCGTGAACTGGCCGGAAATTGAGCGTGATGCGCGCCGTCTGCTCACGCGCAGTAAGGATATCCGG
GTGTTGATCCTGCTGCTGCGCAGTCGCATCCAGCAGGCTGGCGCACAGGGACTGGCGGAAATGCTCACAC
AACTGGCAGAACTGAGCGTAATCTGGTCTGATGCACTCCATCCACAGCTGCTTACCGGCGAAGGCGCATC
CGCAGAATCTATTGAAGATGCGGCGCTGGCGCGCAGTAATGCCCTGGCGGCGCGCTGGATCACGAAGGCG
TGA