SecReT6
Protein ID: 16759253
SecReT6 ID24
T6SS typei3
Gene symbol-
Locus tagSTY0288
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T6SS(s) in this replicon]
Location [Strand]303553..304548 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ8Z979
KEGG IDsty:STY0288, stt:t2596
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-91, Aligned region: 10..310
Protein Sequence: 331 a.a.     [Download]
>gi|16759253|ref|NP_454870.1| hypothetical protein STY0288 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MTGALDQAQKAPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKFRLGQTPTMTFAPREIAQVSWQDGRLH
LSLYSLGLWGPNGPLPLHYTELALNRSESRHDPTLVHFSNIFHYRWLTQFWQAWRSGQSAGGGLDKPEHD
RFAFYIASISGQDLRESAESPLSDHVRLAASAHLVRESRNPDGLAATLAHYFSVPFAVKEFALHWITVAN
DEITRLGTPAQSSVLGNGALIGQAVPDMQYKFRLIIGPLTLEDYLRFLPGGNNLPVLTELVRTFIGFEYC
WEIELQLKPHAAPPAVIGGAQRLGWTAWAGKAMHDRPVTGMIFEPEHGLTH
 
Nucleotide Sequence: 996 bp     [Download]
>gi|16758993|ref|NC_003198.1|:c304548-303553 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGACCGGCGCTCTCGACCAGGCGCAGAAAGCCCCCTGGCGTTACGGATTCCTGAACCTGATGCGACGCG
TGGATGCCCAGCTCTGTGATACTCCGGCAGGCAGTATCTGGCAGCCTCGGATGGAAAAATTCCGTCTGGG
ACAGACGCCGACGATGACCTTTGCACCACGGGAAATCGCCCAGGTCAGCTGGCAGGATGGACGCCTGCAC
CTGAGCCTGTACAGCCTCGGACTATGGGGGCCAAACGGCCCGTTGCCGCTGCACTATACCGAGCTGGCGC
TAAATCGCTCAGAGAGTCGTCACGATCCGACGCTGGTTCATTTTTCCAATATTTTTCACTACCGCTGGCT
GACGCAGTTCTGGCAGGCATGGCGCAGCGGCCAGTCCGCTGGTGGCGGGCTGGACAAACCGGAACACGAC
CGTTTTGCGTTTTATATCGCCAGTATCAGCGGGCAGGATCTACGGGAAAGCGCCGAAAGCCCGCTGTCAG
ATCATGTTCGCCTGGCGGCCTCCGCCCATCTGGTACGCGAGTCGCGCAATCCTGACGGGCTGGCCGCCAC
GCTGGCGCACTATTTCAGCGTACCTTTTGCGGTGAAAGAGTTTGCCCTGCACTGGATAACGGTGGCGAAC
GATGAAATCACCCGTCTGGGCACGCCCGCGCAGTCTTCGGTGCTGGGCAACGGGGCGCTTATCGGCCAGG
CCGTACCGGATATGCAGTACAAATTCCGGCTAATTATCGGCCCGCTCACGCTGGAGGATTACCTGCGTTT
TCTGCCCGGCGGCAACAATCTGCCCGTGCTGACAGAACTGGTGCGTACGTTCATCGGTTTTGAATATTGC
TGGGAAATTGAGCTGCAGTTGAAGCCCCATGCCGCACCGCCTGCGGTGATCGGCGGCGCGCAGCGGCTTG
GCTGGACGGCCTGGGCAGGTAAAGCCATGCATGACCGTCCGGTGACCGGCATGATTTTTGAACCTGAACA
CGGCTTAACCCACTGA