SecReT6
Protein ID: 16759254
SecReT6 ID24
T6SS typei3
Gene symbol-
Locus tagSTY0289
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T6SS(s) in this replicon]
Location [Strand]304545..306428 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ8Z978
KEGG IDsty:STY0289
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.80E-210, Aligned region: 5..625
Protein Sequence: 627 a.a.     [Download]
>gi|16759254|ref|NP_454871.1| hypothetical protein STY0289 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MDPRLLEYYNRELSYLRETGAEFATLHPKIAARLGMQGTDIADPYVERMIEAFSFLSARTQLKIDAEFPR
FTQRLLEVVNPNYVTPTPSMAVVKLYPDTQEGDLAKGVTVPRDTAFVSPIPEGENTACQFRSSQDVTLWP
LSIEEVRLTAAPPDMPALHRYLPPNIHVAGALRITLRTFGELAFSELAGPARLPFYLCGEERIASHLFEL
LHTSAVATLAGEPGHFDGELNVNLQHPVAHEGLEPGQGLLPLAWNVFHGHNLLHEFFACPERFYFFTPTG
LSAGLQKVQGNVAEIVILLNRLPPDWLIHQTDAAQFSLFCTPVINLFPRTTTRIEVTHSVTEQHLVVDRT
RPLDYEVFSVQEVEGLEAETTRKMIFRPLYHTRNNDEGNHGRYFSLRREPRRSSESARRYGTRTPYTGSE
VFLSLVDQHEAPYPENLRHITVTAMVTNRDLPCLIPRNGRDDLTVDAAIPVAGVGLIRPPRPPQPPLAER
EMAWRLIRQLSFNYLPLADLDHRTGGQALRDLLNLFIPAHDSPQSRQVRSLIGCKTTPVTRRLPGSGLLV
YGRGVSCELTVDEEGFSGISPYLFGLVLEHYIARHVSINTFSQMTLHSMQRGHVMTWPVRTGQRGSV
 
Nucleotide Sequence: 1884 bp     [Download]
>gi|16758993|ref|NC_003198.1|:c306428-304545 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGGATCCACGGCTACTGGAGTATTACAACCGCGAACTGAGTTACCTGCGGGAGACCGGTGCTGAGTTCG
CCACCCTCCATCCCAAAATTGCCGCCCGACTGGGGATGCAGGGAACCGATATTGCCGACCCGTATGTGGA
ACGCATGATCGAGGCGTTCAGCTTTCTGAGCGCCCGCACTCAGCTAAAAATTGACGCCGAATTTCCCCGC
TTCACACAGCGGTTACTGGAAGTCGTCAACCCCAATTACGTCACCCCCACGCCATCGATGGCAGTGGTAA
AGCTGTATCCCGATACGCAGGAAGGCGACCTGGCGAAAGGGGTCACCGTGCCGCGCGATACCGCGTTCGT
TTCCCCCATCCCGGAAGGCGAAAATACCGCCTGCCAGTTTCGCAGCAGCCAGGACGTCACGCTGTGGCCG
CTGTCCATCGAGGAGGTACGCCTGACCGCCGCGCCGCCGGATATGCCCGCCCTGCACCGCTATCTGCCGC
CTAATATTCATGTCGCCGGGGCATTGCGCATCACCCTGCGAACCTTCGGGGAACTGGCTTTCAGCGAGCT
GGCCGGTCCGGCACGGCTGCCCTTTTACCTCTGCGGCGAAGAACGCATTGCGTCACACCTGTTTGAGCTG
CTACATACCAGCGCCGTCGCCACACTGGCCGGAGAACCCGGTCACTTTGACGGCGAACTGAATGTGAATC
TTCAACACCCGGTGGCGCACGAAGGGCTGGAGCCAGGGCAGGGGCTGCTGCCGCTCGCCTGGAACGTGTT
TCATGGGCATAATCTGCTGCATGAATTTTTCGCCTGTCCGGAACGGTTTTACTTCTTCACCCCGACCGGA
TTGTCTGCCGGTCTACAAAAGGTGCAGGGCAATGTGGCGGAAATTGTTATACTGCTTAACCGCCTGCCGC
CGGACTGGCTGATTCATCAGACGGACGCCGCACAGTTCAGCCTGTTCTGTACGCCGGTGATCAACCTGTT
TCCCCGCACCACCACCCGGATTGAAGTCACTCACAGCGTGACGGAACAGCATCTGGTGGTGGATCGTACC
CGTCCGCTGGATTACGAGGTGTTTTCTGTCCAGGAAGTCGAAGGCCTGGAAGCGGAAACCACACGGAAGA
TGATTTTTCGTCCGCTGTATCACACCCGTAATAATGACGAAGGCAACCACGGGCGTTATTTTTCACTGCG
TCGTGAGCCGCGCCGATCGTCAGAAAGCGCCCGCCGCTATGGCACCCGAACCCCCTATACCGGCTCGGAA
GTCTTCCTCTCGCTGGTTGATCAGCATGAAGCGCCCTACCCGGAAAATCTGCGCCATATCACCGTCACGG
CAATGGTGACTAACCGCGATCTGCCCTGCCTTATTCCACGTAATGGCCGGGATGATCTGACCGTAGATGC
GGCGATTCCGGTGGCGGGCGTGGGTCTTATCAGACCGCCGCGCCCGCCGCAGCCGCCGCTGGCTGAACGC
GAAATGGCCTGGCGGCTGATCCGGCAGTTGTCGTTTAATTATCTGCCGCTGGCCGATCTGGATCACCGCA
CCGGCGGCCAGGCGCTGCGCGATCTGCTGAACCTGTTTATCCCGGCTCACGACAGCCCGCAGTCGCGCCA
GGTGCGCAGCCTGATTGGCTGCAAAACCACCCCGGTGACCCGCCGCCTACCCGGCTCCGGCCTGTTGGTC
TATGGCCGGGGCGTCAGTTGCGAACTGACCGTGGACGAAGAAGGATTTTCCGGTATCAGTCCTTACCTGT
TCGGTCTGGTGCTGGAACACTATATTGCCCGCCATGTTTCCATTAATACCTTCTCGCAGATGACACTGCA
CTCGATGCAACGCGGGCATGTCATGACCTGGCCGGTCAGAACCGGGCAACGGGGGAGCGTATGA