SecReT6
Protein ID: 16759259
SecReT6 ID24
T6SS typei3
Gene symbol-
Locus tagSTY0294
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T6SS(s) in this replicon]
Location [Strand]309016..311679 [+]
ProductClpB-like protein
NoteTssH
UniProt IDQ8Z973
KEGG IDsty:STY0294, stt:t2591
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 235..313
AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 609..776
AAA [PF00004], Evalue: 1.20E-18, Aligned region: 236..339
AAA [PF00004], Evalue: 1.20E-18, Aligned region: 381..402
AAA [PF00004], Evalue: 1.20E-18, Aligned region: 615..699
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 236..313
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 614..732
ClpB_D2-small [PF10431], Evalue: 5.40E-12, Aligned region: 785..856
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 213..256
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 277..314
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 383..405
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 474..492
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 605..659
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 678..708
AAA_22 [PF13401], Evalue: 9.20E-08, Aligned region: 236..404
AAA_22 [PF13401], Evalue: 9.20E-08, Aligned region: 613..634
AAA_22 [PF13401], Evalue: 9.20E-08, Aligned region: 676..706
Sigma54_activat [PF00158], Evalue: 3.70E-06, Aligned region: 232..252
Sigma54_activat [PF00158], Evalue: 3.70E-06, Aligned region: 614..714
IstB_IS21 [PF01695], Evalue: 2.10E-05, Aligned region: 220..295
IstB_IS21 [PF01695], Evalue: 2.10E-05, Aligned region: 614..634
NACHT [PF05729], Evalue: 4.90E-05, Aligned region: 236..263
NACHT [PF05729], Evalue: 4.90E-05, Aligned region: 614..644
AAA_25 [PF13481], Evalue: 6.00E-05, Aligned region: 236..311
AAA_25 [PF13481], Evalue: 6.00E-05, Aligned region: 498..530
AAA_25 [PF13481], Evalue: 6.00E-05, Aligned region: 609..640
AAA_25 [PF13481], Evalue: 6.00E-05, Aligned region: 676..697
Zeta_toxin [PF06414], Evalue: 0.00011, Aligned region: 236..256
Zeta_toxin [PF06414], Evalue: 0.00011, Aligned region: 351..404
Zeta_toxin [PF06414], Evalue: 0.00011, Aligned region: 608..664
AAA_19 [PF13245], Evalue: 0.00012, Aligned region: 234..259
AAA_19 [PF13245], Evalue: 0.00012, Aligned region: 386..413
AAA_19 [PF13245], Evalue: 0.00012, Aligned region: 430..456
AAA_19 [PF13245], Evalue: 0.00012, Aligned region: 612..636
AAA_29 [PF13555], Evalue: 0.00037, Aligned region: 226..253
AAA_29 [PF13555], Evalue: 0.00037, Aligned region: 612..639
AAA_14 [PF13173], Evalue: 0.0015, Aligned region: 236..316
AAA_14 [PF13173], Evalue: 0.0015, Aligned region: 382..404
AAA_14 [PF13173], Evalue: 0.0015, Aligned region: 613..696
AAA_17 [PF13207], Evalue: 0.0027, Aligned region: 237..248
AAA_17 [PF13207], Evalue: 0.0027, Aligned region: 614..650
AAA_18 [PF13238], Evalue: 0.0057, Aligned region: 236..249
AAA_18 [PF13238], Evalue: 0.0057, Aligned region: 616..647
RNA_helicase [PF00910], Evalue: 0.006, Aligned region: 189..210
RNA_helicase [PF00910], Evalue: 0.006, Aligned region: 237..257
RNA_helicase [PF00910], Evalue: 0.006, Aligned region: 615..636
Arch_ATPase [PF01637], Evalue: 0.0077, Aligned region: 215..251
Arch_ATPase [PF01637], Evalue: 0.0077, Aligned region: 290..318
Arch_ATPase [PF01637], Evalue: 0.0077, Aligned region: 381..409
Arch_ATPase [PF01637], Evalue: 0.0077, Aligned region: 613..628
Hpr_kinase_C [PF07475], Evalue: 0.0096, Aligned region: 236..247
Hpr_kinase_C [PF07475], Evalue: 0.0096, Aligned region: 612..633
Protein Sequence: 887 a.a.     [Download]
>gi|16759259|ref|NP_454876.1| ClpB-like protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
METPVSRSALYGKLAGPLFRSLESATAFCKLRSNPWGELTHWLHQLTQQPDNDILHVLRHYQIPLSDVEK
ALLRQLDMLPAGASAISDFSHHIDLSVEKAWMLASVRYGDNKIRSGWLLLALLTTPELRRVLSSICAPLA
TLPVDELTEILPSLIETSPEAQERPYDGSGLASAIPGESSQAIPNGVQDGKSALAKYCQDMTAQARDGKI
DPVTGREHEIRTMTDILLRRRQNNPLLTGEAGVGKTAVVEGFALAIAQGEVPPALREVRLLALDVGALLA
GASMKGEFESRLKGLLEEAGRSPQPVILFVDEVHTLVGAGGASGTGDAANLLKPALACGTLRTIGATTWS
EYKRHIEKDPALTRRFQVLQIAEPEEIPAMEMVRGLVDTLEKHHNVLILDEAVRAAVQLSHRYIPARQLP
DKAISLLDTAAVRVALTLHTPPASVQFLRQQLKAAEMERSLLQKQEKMGIQSDERCDALTARIFSLNDEL
TASESRWQRELELVHTLQELRVAESDADDKTTLQQAETALREWQGDAPVVFPEVSAAIVAAIVADWTGIP
AGRMVKDEASQVLELPARLAQRVTGQDGALAQIGERIQTARAGLGDPRKPVGVFMLAGPSGVGKTETALA
LAEAIYGGEQNLVTINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRHPWSVVLLDEIEKAHHDVH
ELFYQVFDKGGMEDGEGTHVDFKNTTLLLTTNVGSDLISQMCEDPALMPDATGLKEALMPELRKHFPAAF
LGRVTVIPYLPLDETSRGVIARLHLDRLVARMGEQHGVTLTYSEELVAHIVACCPMHETGARLLIGYIEQ
HILPQLSRYWLQAMTEKAAIRQIDIGVNGDEQIVFETTSQEGICQKS
 
Nucleotide Sequence: 2664 bp     [Download]
>gi|16758993|ref|NC_003198.1|:309016-311679 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGGAAACTCCTGTTTCACGCAGTGCGTTATATGGAAAACTGGCCGGCCCACTATTCCGGTCGCTGGAAT
CGGCAACGGCATTTTGCAAACTACGCTCTAATCCCTGGGGTGAGCTGACTCACTGGCTGCACCAGTTAAC
ACAGCAGCCCGATAACGATATTCTCCACGTTCTTCGGCATTACCAGATCCCTCTTTCTGATGTGGAGAAA
GCGTTACTCCGGCAACTGGATATGCTGCCCGCCGGGGCCAGCGCCATTAGTGATTTTTCTCACCATATCG
ATCTCAGCGTTGAAAAGGCCTGGATGCTGGCGAGCGTCCGTTACGGCGATAACAAAATTCGCAGCGGCTG
GTTGCTGCTGGCCTTGTTGACCACGCCAGAACTGCGTCGGGTACTGAGCAGTATCTGCGCGCCGCTGGCC
ACGCTTCCGGTTGATGAACTGACGGAAATACTGCCCTCGTTGATCGAAACATCGCCGGAAGCGCAGGAGC
GCCCTTACGACGGCTCCGGTCTGGCATCAGCCATTCCCGGTGAAAGCAGCCAGGCGATTCCCAACGGCGT
GCAGGACGGTAAATCCGCGCTGGCAAAATACTGTCAGGACATGACGGCACAGGCGCGCGACGGCAAAATC
GACCCGGTGACGGGGCGTGAGCATGAAATCCGCACCATGACGGATATTCTGCTGCGCCGTCGCCAGAATA
ATCCCCTACTGACTGGTGAGGCGGGCGTCGGAAAGACGGCGGTCGTCGAAGGTTTTGCCCTCGCGATTGC
GCAGGGGGAAGTGCCGCCCGCGCTGCGGGAAGTACGGCTGCTGGCGCTGGACGTTGGCGCTCTGTTGGCC
GGAGCCAGCATGAAAGGCGAGTTTGAATCGCGTCTGAAAGGGTTACTGGAAGAGGCCGGGCGCTCGCCGC
AGCCGGTTATTCTGTTTGTCGATGAAGTTCACACTCTGGTGGGCGCGGGCGGCGCATCCGGCACGGGCGA
TGCCGCTAACCTGCTGAAACCGGCGCTGGCGTGCGGCACCCTGCGGACTATCGGCGCCACCACCTGGAGC
GAATACAAGCGCCATATTGAGAAAGATCCGGCGCTGACCCGTCGTTTTCAGGTGTTGCAGATTGCCGAGC
CGGAAGAGATCCCCGCAATGGAAATGGTGCGTGGTCTGGTGGATACGCTGGAAAAACACCATAACGTACT
GATTCTGGATGAGGCGGTACGTGCGGCGGTACAGCTTTCTCACCGCTACATTCCCGCCCGGCAGTTGCCG
GATAAGGCCATCAGCCTACTGGATACCGCCGCGGTCCGCGTGGCGCTGACGCTGCACACGCCGCCTGCCA
GCGTACAGTTCCTGCGTCAGCAGCTAAAAGCGGCGGAAATGGAACGGTCGCTGTTGCAGAAGCAGGAAAA
AATGGGGATTCAGTCAGATGAGCGGTGCGATGCGCTGACGGCGCGAATTTTCTCGCTCAACGATGAACTG
ACTGCATCCGAATCCCGCTGGCAGCGGGAGCTGGAACTGGTACATACGTTGCAGGAACTGCGTGTCGCAG
AGTCTGATGCTGATGACAAAACCACGCTGCAACAGGCCGAAACAGCGCTAAGGGAGTGGCAGGGCGACGC
GCCGGTGGTGTTCCCGGAAGTCAGCGCGGCGATTGTCGCGGCGATTGTCGCCGACTGGACCGGTATTCCT
GCCGGGCGCATGGTGAAAGATGAGGCCAGCCAGGTGCTGGAACTGCCTGCCCGACTGGCGCAACGCGTTA
CCGGGCAAGACGGCGCGCTGGCGCAGATTGGTGAACGTATTCAGACCGCCAGGGCGGGACTGGGCGATCC
ACGCAAACCGGTGGGCGTGTTTATGCTGGCCGGGCCGTCCGGTGTCGGTAAAACCGAAACCGCGCTGGCG
CTGGCGGAGGCTATCTACGGCGGTGAGCAGAACCTGGTAACCATCAATATGAGCGAGTTCCAGGAGGCTC
ACACCGTTTCCACACTGAAAGGCGCGCCGCCCGGCTATGTGGGCTATGGCGAGGGTGGTGTGCTGACGGA
AGCGGTGCGTCGTCACCCCTGGAGCGTAGTGCTGCTCGACGAGATCGAAAAAGCGCACCATGACGTCCAT
GAACTCTTCTATCAGGTGTTTGACAAGGGCGGGATGGAGGACGGTGAGGGAACACATGTCGATTTCAAAA
ACACCACGCTACTACTCACCACCAATGTAGGTTCCGACCTCATCAGCCAGATGTGTGAAGATCCGGCCTT
AATGCCCGATGCTACGGGGCTTAAAGAGGCGCTAATGCCGGAATTGCGCAAGCATTTCCCGGCGGCATTT
CTGGGCCGCGTGACGGTGATCCCTTACCTGCCGCTGGATGAAACGTCGCGTGGCGTGATTGCCCGTCTGC
ATCTTGACCGGCTGGTGGCGCGGATGGGTGAACAGCACGGGGTGACGCTGACGTATAGTGAGGAACTGGT
CGCACATATTGTGGCGTGCTGTCCAATGCATGAAACGGGCGCGCGGTTGCTGATTGGCTACATCGAACAG
CACATCCTGCCACAACTGTCGCGCTACTGGTTGCAGGCCATGACGGAAAAAGCCGCTATCAGGCAGATTG
ATATCGGCGTTAATGGTGATGAGCAGATTGTTTTTGAGACAACCTCGCAGGAGGGAATATGCCAAAAGAG
TTAA