SecReT6
Protein ID: 16759262
SecReT6 ID24
T6SS typei3
Gene symbol-
Locus tagSTY0297
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T6SS(s) in this replicon]
Location [Strand]312119..312661 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ8Z970
KEGG IDstt:t2588, sty:STY0297
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.70E-60, Aligned region: 11..164
Protein Sequence: 180 a.a.     [Download]
>gi|16759262|ref|NP_454879.1| hypothetical protein STY0297 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDRKFLDIDIDNF
NERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALNQLLEARTQLANLQTYMDGKA
GAENLVNKLLQDPTLLKTLANAPKSAATQQGVSADNESAE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|16758993|ref|NC_003198.1|:312119-312661 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGGCTATCAACAATAGCGCGCAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGCAGATTGAATATG
ACGTAGAGATTTACGGTTCCGAGAAAAAAATCGAGCTGCCGTTCGTGATGGCGGTGCTGGCCGATCTGGC
CGGGAAACCGCGTGAAGAACTGCCGCCGGTGACGGATCGCAAATTCCTCGATATTGATATTGATAACTTC
AATGAGCGCATGAAAGCCATTGCGCCGCGCGTGGCGTTCGCTGTGCCGAATACGCTGACGGGTGAAGGTC
AGTTGATGGTCGATATCACCCTGGAAAATATGGACGACTTTTCGCCGGCACAGATTGCCCGCAAGGTGGA
CGCCCTGAACCAGTTACTGGAAGCCCGCACTCAACTGGCGAACCTCCAGACCTACATGGATGGCAAGGCC
GGGGCGGAAAATCTGGTCAATAAACTGTTGCAGGACCCGACTCTGCTGAAAACGCTGGCGAATGCGCCGA
AATCGGCCGCTACCCAGCAAGGTGTGTCAGCGGATAATGAATCAGCGGAATAA