SecReT6
Protein ID: 16759265
SecReT6 ID24
T6SS typei3
Gene symbol-
Locus tagSTY0302
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T6SS(s) in this replicon]
Location [Strand]315281..315766 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ93IS5
KEGG IDstt:t2584, sty:STY0302
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-41, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|16759265|ref|NP_454882.1| hypothetical protein STY0302 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDHYIDRASPNLF
KYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIASRETVELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
 
Nucleotide Sequence: 486 bp     [Download]
>gi|16758993|ref|NC_003198.1|:315281-315766 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGGCTTATGACATTTTTTTAAAAATTGACGGCATTGATGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGCGGCCTCGG
CTCCGGTAAGGTCTCCGTCACTAATCTGGATTTTGATCACTATATCGATCGCGCCAGCCCGAACCTGTTC
AAATACTGCGCCTCCGGCAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTATACCTTCACCGACCTGATTGTCGCCGTGGTTTCCCCGAGCGGCAGCCACGATGG
TGAAATCGCCTCCCGTGAAACGGTCGAGCTTTCTTTCAGCACTGTGAAACAGGAATACGTGGTGCAGAAC
CAGCAGGGCGGCAGCGGCGGCACTATCACCGCAGGTTACGACTTCAAGGCGAACAAAGAAATTTAA