SecReT6
Protein ID: 167627598
SecReT6 ID476
T6SS typeii
Gene symbol-
Locus tagFphi_1372
StrainFrancisella philomiragia subsp. philomiragia ATCC 25017
Repliconchromosome [GenBank: NC_010336] [Browse all T6SS(s) in this replicon]
Location [Strand]1498351..1498872 [-]
Producthypothetical protein
NoteIglG
UniProt IDB0TYC1
KEGG IDfph:Fphi_1372
PDB IDNA
Domain hit(s) vs Pfam DUF4280 [PF14107], Evalue: 7.10E-17, Aligned region: 58..167
Protein Sequence: 173 a.a.     [Download]
>gi|167627598|ref|YP_001678098.1| hypothetical protein Fphi_1372 [Francisella philomiragia subsp. philomiragia ATCC 25017]
MLDIINDSLKRLEAISNNDEDIRDSISNLVSELNNIKILLNPTKLNLSSSASTLIPSMTAQIKCSFSLAP
GVYLSTRIKTLAGNLPASNITDSKLGANILPFAGCTNPANPTMNPFVFPWVCIPNLSPFIPTNPTTLLEG
APINTMSSKAICTFAPGGIVNFISSGQINVKTS
 
Nucleotide Sequence: 522 bp     [Download]
>ref|NC_010336.1|:c1498872-1498351 hypothetical protein Fphi_1372 [Francisella philomiragia subsp. philomiragia ATCC 25017]
ATGCTAGATATTATAAATGACTCACTAAAACGATTAGAAGCTATATCTAACAATGATGAAGATATTAGAG
ACTCAATCTCGAATCTAGTATCAGAACTTAATAATATAAAAATATTACTAAATCCAACAAAGCTTAATCT
GTCAAGTAGTGCCTCCACATTGATACCTTCGATGACTGCGCAAATTAAATGTTCATTTAGTCTTGCACCA
GGAGTCTATTTAAGCACAAGGATAAAAACACTAGCAGGCAACTTGCCAGCTTCAAATATTACAGATTCCA
AACTCGGAGCCAATATACTTCCTTTTGCAGGATGTACCAACCCAGCAAATCCAACAATGAATCCTTTTGT
GTTCCCATGGGTTTGCATACCGAATCTTTCTCCTTTTATACCAACAAATCCAACCACTCTATTAGAAGGA
GCACCAATAAATACTATGAGTAGCAAAGCAATATGTACATTTGCCCCTGGAGGCATTGTTAACTTCATAA
GTAGTGGACAAATTAATGTAAAAACATCTTAA