SecReT6
Protein ID: 169633786
SecReT6 ID254
T6SS typei4b
Gene symbol-
Locus tagABSDF2237
StrainAcinetobacter baumannii SDF
Repliconchromosome [GenBank: NC_010400] [Browse all T6SS(s) in this replicon]
Location [Strand]2061603..2062409 [-]
Producthypothetical protein
NoteTssL
UniProt IDB0VRP2
KEGG IDabm:ABSDF2237
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-52, Aligned region: 34..239
Protein Sequence: 268 a.a.     [Download]
>gi|169633786|ref|YP_001707522.1| hypothetical protein ABSDF2237 [Acinetobacter baumannii SDF]
MSQSTGAPSLFDDGQIGTGGNNNSQSQVKLQAINLIDLLHDGFYLIFLIRNQYVPADPQRFREKILDLLN
RFEQQAKKLQFSADDIHDAKYAFCALIDETIVTQQDPSYFNLQNSWLISPLQLSLFGSQLAGYQFFEILE
QLRSRGKDRLAALEVFHYCLLLGFQGKYRIESIESLNHLVARVGDEIDYLKGKKVAFSPFSAIPDQIRNI
IHRELPFFWILIFLLIFALLTFAGLRFMLNNQNDKALSNYQNVISAPQEQAHITIYLP
 
Nucleotide Sequence: 807 bp     [Download]
>gi|169632029|ref|NC_010400.1|:c2062409-2061603 Acinetobacter baumannii SDF chromosome, complete genome
ATGTCACAATCTACAGGTGCTCCTTCTTTATTTGACGATGGGCAAATTGGGACAGGGGGGAATAATAATA
GCCAGTCCCAAGTAAAATTACAGGCAATTAATCTGATTGATTTATTGCATGATGGTTTTTACTTAATCTT
TTTAATTCGAAATCAGTATGTGCCAGCTGATCCACAGCGCTTTCGTGAAAAAATTCTAGATTTGCTTAAT
CGATTTGAGCAACAAGCGAAAAAGTTACAATTTTCAGCTGATGATATTCATGATGCTAAATATGCGTTTT
GTGCGCTAATTGATGAAACGATCGTAACCCAGCAAGATCCAAGCTATTTTAATTTACAAAATTCTTGGTT
AATTAGTCCATTACAGTTAAGCCTGTTTGGTTCACAGTTAGCGGGTTATCAATTCTTCGAAATTTTAGAG
CAACTACGTAGTCGTGGAAAAGATCGATTAGCTGCTCTTGAAGTCTTCCATTACTGCTTATTATTAGGTT
TTCAGGGTAAATACCGAATTGAGTCAATTGAAAGCCTTAACCATTTGGTGGCACGAGTAGGCGATGAAAT
TGATTATCTGAAAGGGAAAAAAGTGGCTTTTTCGCCATTCTCGGCAATTCCTGATCAGATACGAAATATT
ATCCATCGTGAGTTACCTTTTTTCTGGATTTTGATTTTCTTATTGATTTTTGCATTACTTACCTTTGCAG
GTTTAAGATTTATGCTTAACAATCAAAATGATAAAGCATTATCTAATTATCAAAATGTGATTTCTGCCCC
ACAAGAGCAGGCACATATTACAATTTACTTACCTTGA