SecReT6
Protein ID: 169633787
SecReT6 ID254
T6SS typei4b
Gene symbol-
Locus tagABSDF2238
StrainAcinetobacter baumannii SDF
Repliconchromosome [GenBank: NC_010400] [Browse all T6SS(s) in this replicon]
Location [Strand]2062427..2063791 [-]
Producthypothetical protein
NoteTssK
UniProt IDB0VRP3
KEGG IDabm:ABSDF2238
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-125, Aligned region: 19..451
Protein Sequence: 454 a.a.     [Download]
>gi|169633787|ref|YP_001707523.1| hypothetical protein ABSDF2238 [Acinetobacter baumannii SDF]
MFKAEKVLWGEGLFLRPQHFQIQDTYHEQRLNHTVRAVVPFSYGVQKLSFDEAQLSTHILALESVEMIWQ
DGEIYQAPAYDLLPEPILLDELNLRGEMVIYLALPLLQANKQNLIDQNQSQKGRYQSHLVETHDLFTNAT
EADISLLRRRAVFKLLDAHSNPDHNLDGFLHLPIGKIKRQSSGAFEIDRKFIPPILHVDASETLVSNLKR
TLNVIKAKIKTIQTNNRENEQKLIEFRSGDIVSFWLVNALNTAHAGLSHFLQYPQIHPERLFFELLRLAG
SLLTFSTAYEVDQLPAYKHHNLQESFTQLDTILRDLLDTIISSRYISITLKEIRPSYWVGSLETDKITRD
TRLYIAVSSSAMQTHELIQIVPLRFKIGSTLDVEQRVVAALPAIPLHHLIQVPTAIPVRSGVSYFEIELH
HELYQRMLDSETICIYVPAGFQDISIELIAVMNA
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|169632029|ref|NC_010400.1|:c2063791-2062427 Acinetobacter baumannii SDF chromosome, complete genome
ATGTTTAAAGCTGAAAAAGTCCTGTGGGGCGAAGGTTTATTTTTAAGACCTCAACATTTCCAGATTCAAG
ATACCTATCATGAACAACGTTTAAATCATACGGTTCGTGCTGTTGTGCCATTTTCCTATGGCGTTCAAAA
ACTTAGTTTTGATGAAGCACAGTTAAGTACGCATATTCTTGCACTTGAATCGGTAGAAATGATTTGGCAA
GACGGTGAAATATATCAAGCGCCTGCTTATGACTTATTACCTGAACCTATTTTGCTTGATGAGCTTAATT
TACGTGGTGAAATGGTCATCTATTTGGCATTACCATTATTACAAGCCAATAAACAAAATTTAATCGATCA
AAATCAATCACAGAAGGGGCGCTATCAATCACATTTGGTTGAGACTCACGATCTGTTCACAAACGCGACA
GAAGCTGATATCAGCTTATTACGTCGCCGAGCTGTGTTTAAATTATTAGATGCACATAGTAATCCTGATC
ATAATTTAGATGGTTTTCTGCATTTGCCAATAGGTAAAATTAAACGTCAGAGTTCAGGTGCTTTTGAAAT
TGACCGCAAATTTATTCCGCCCATTTTGCATGTCGATGCATCTGAGACTTTGGTTTCAAATTTAAAAAGA
ACCTTAAATGTTATTAAGGCAAAAATTAAAACGATTCAAACCAATAACCGAGAAAATGAGCAGAAATTAA
TTGAATTCCGTTCAGGTGATATCGTTTCGTTTTGGTTGGTAAATGCTTTAAATACTGCTCATGCTGGTCT
GAGCCATTTCTTGCAATATCCGCAAATTCACCCGGAACGATTATTCTTTGAATTGCTACGTTTAGCAGGT
TCATTATTAACTTTCTCGACAGCTTATGAAGTTGATCAGTTGCCTGCATATAAACATCATAATTTGCAAG
AGAGCTTCACCCAGCTCGACACAATTTTACGTGATTTACTCGATACGATTATTTCGAGTCGTTACATCAG
TATTACCCTTAAAGAAATTCGCCCTTCATATTGGGTGGGAAGTCTCGAAACCGATAAGATTACTCGAGAT
ACCAGACTTTATATTGCTGTATCAAGTAGCGCGATGCAGACCCATGAGTTGATTCAAATCGTTCCTCTAC
GTTTTAAAATCGGTAGTACTTTAGATGTTGAACAACGTGTTGTTGCAGCATTACCAGCAATTCCATTACA
CCACTTAATCCAAGTTCCAACTGCTATTCCAGTACGTTCTGGTGTGAGCTATTTTGAAATCGAACTGCAT
CATGAGCTCTATCAACGTATGTTGGATTCAGAAACGATTTGTATTTATGTTCCGGCTGGATTCCAAGATA
TCAGTATTGAGCTGATTGCGGTCATGAACGCTTAA