SecReT6
Protein ID: 169633789
SecReT6 ID254
T6SS typei4b
Gene symbol-
Locus tagABSDF2240
StrainAcinetobacter baumannii SDF
Repliconchromosome [GenBank: NC_010400] [Browse all T6SS(s) in this replicon]
Location [Strand]2064926..2067616 [-]
ProductClpA/B-type chaperone
NoteTssH
UniProt IDB0VRP5
KEGG IDabm:ABSDF2240
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-43, Aligned region: 232..310
AAA_2 [PF07724], Evalue: 1.20E-43, Aligned region: 609..777
AAA [PF00004], Evalue: 1.50E-23, Aligned region: 233..346
AAA [PF00004], Evalue: 1.50E-23, Aligned region: 614..732
AAA_5 [PF07728], Evalue: 5.60E-14, Aligned region: 233..255
AAA_5 [PF07728], Evalue: 5.60E-14, Aligned region: 613..734
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 13..76
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 210..255
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 277..312
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 487..517
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 608..657
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 679..707
ClpB_D2-small [PF10431], Evalue: 7.10E-12, Aligned region: 387..400
ClpB_D2-small [PF10431], Evalue: 7.10E-12, Aligned region: 783..853
AAA_22 [PF13401], Evalue: 5.90E-09, Aligned region: 232..326
AAA_22 [PF13401], Evalue: 5.90E-09, Aligned region: 475..504
AAA_22 [PF13401], Evalue: 5.90E-09, Aligned region: 610..640
Sigma54_activat [PF00158], Evalue: 8.90E-08, Aligned region: 230..251
Sigma54_activat [PF00158], Evalue: 8.90E-08, Aligned region: 610..720
AAA_19 [PF13245], Evalue: 1.10E-07, Aligned region: 233..253
AAA_19 [PF13245], Evalue: 1.10E-07, Aligned region: 609..635
AAA_25 [PF13481], Evalue: 2.70E-07, Aligned region: 233..305
AAA_25 [PF13481], Evalue: 2.70E-07, Aligned region: 609..640
AAA_25 [PF13481], Evalue: 2.70E-07, Aligned region: 836..868
AAA_14 [PF13173], Evalue: 4.20E-07, Aligned region: 233..336
AAA_14 [PF13173], Evalue: 4.20E-07, Aligned region: 611..696
AAA_17 [PF13207], Evalue: 9.80E-07, Aligned region: 233..280
AAA_17 [PF13207], Evalue: 9.80E-07, Aligned region: 612..650
IstB_IS21 [PF01695], Evalue: 1.50E-06, Aligned region: 227..293
IstB_IS21 [PF01695], Evalue: 1.50E-06, Aligned region: 613..633
NACHT [PF05729], Evalue: 3.60E-06, Aligned region: 233..331
NACHT [PF05729], Evalue: 3.60E-06, Aligned region: 613..651
AAA_18 [PF13238], Evalue: 8.80E-06, Aligned region: 233..263
AAA_18 [PF13238], Evalue: 8.80E-06, Aligned region: 491..544
AAA_18 [PF13238], Evalue: 8.80E-06, Aligned region: 614..643
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 66..107
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 212..246
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 285..382
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 475..494
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 609..659
Zeta_toxin [PF06414], Evalue: 2.00E-05, Aligned region: 233..253
Zeta_toxin [PF06414], Evalue: 2.00E-05, Aligned region: 608..653
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 232..251
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 303..313
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 577..635
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 682..708
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 225..249
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 608..637
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 717..737
T2SE [PF00437], Evalue: 0.00052, Aligned region: 218..252
T2SE [PF00437], Evalue: 0.00052, Aligned region: 585..682
RNA_helicase [PF00910], Evalue: 0.00092, Aligned region: 234..257
RNA_helicase [PF00910], Evalue: 0.00092, Aligned region: 614..635
AAA_28 [PF13521], Evalue: 0.0018, Aligned region: 233..270
AAA_28 [PF13521], Evalue: 0.0018, Aligned region: 613..636
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 228..253
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 592..636
NTPase_1 [PF03266], Evalue: 0.0044, Aligned region: 233..253
NTPase_1 [PF03266], Evalue: 0.0044, Aligned region: 284..309
NTPase_1 [PF03266], Evalue: 0.0044, Aligned region: 613..634
DUF2075 [PF09848], Evalue: 0.0063, Aligned region: 233..335
DUF2075 [PF09848], Evalue: 0.0063, Aligned region: 388..513
DUF2075 [PF09848], Evalue: 0.0063, Aligned region: 612..644
MobB [PF03205], Evalue: 0.0063, Aligned region: 234..267
MobB [PF03205], Evalue: 0.0063, Aligned region: 612..643
AAA_33 [PF13671], Evalue: 0.0068, Aligned region: 234..305
AAA_33 [PF13671], Evalue: 0.0068, Aligned region: 612..634
Protein Sequence: 896 a.a.     [Download]
>gi|169633789|ref|YP_001707525.1| ClpA/B-type chaperone [Acinetobacter baumannii SDF]
MRVMMSSLKILITKLSTAARTALEKSANACVLQQNYEIEIEHLFLELLNQPLENDLKILLKKYKISADAL
ADDLKETISQLPKGNTRTPIFAKSIVRLFEQAWLLASAEQNPVIRSGHLLVALLTAPDLYQIATRASSLF
DLFPIDSMKHKFLEICEKSVEQQEESKTSSQADELEQAVTPTAKTQKTPALDQYTINLTEKAKNGGIDPV
IGREYEIRLMLDILMRRRQNNPILTGEPGVGKTAVVEGLALKIAQGLVPEALKNVHLHVLDMGLLQAGAS
VKGEFENRLKQVIQEVQSSAHPIILFIDEAHTLIGAGGQAGQNDAANLLKPALARGELRTIAATTWAEYK
QYFEKDAALSRRFQVVKVEEPTEEVAVDMLRAMIPVMQKHFNLQIDDEAIVTAVHASHRYISGRQLPDKA
VSVLDTAAARVALTQNAQPVKLDQLKAQEHNLKLEQQILENEHLQIPIHHERLENLKNQLKSLQSEIQET
QEQWQKELELVRKIQELEAQSHSNESEAYDQINLIRKDLADIQGQQPLVFERVNSQIINEIISDWTGIPV
GKMVNDEIKQILTLEDKLGERVMGQDYALTQLVQGIKTSKAKLEDPNKPQGVFLLVGPSGVGKTETALAL
ANELYGGEQHLITINMSEYQEAHTVSSLKGAPPGYVGYGQGGVLTEAVRRNPYSVVLLDEIEKAHSDVQE
LFYQVFDKGTLEDGEGRVIDFKNTTILLTSNTGSSAIMQACLNQPVEEWPTAEDLIEHLKPILYKQFKPA
FLGRMRVVPYFPLHDDLLVRIIKHKLGKITARIEKQYGTKVQYSDDLVELLLSRCTEVDSGARNVDNILN
STVLPALATEILVALADQKLPKLIMIDAKDDEIQYLLDPVAKPAKKRTSKKLKSEV
 
Nucleotide Sequence: 2691 bp     [Download]
>gi|169632029|ref|NC_010400.1|:c2067616-2064926 Acinetobacter baumannii SDF chromosome, complete genome
TTGAGAGTAATGATGAGTAGTTTAAAAATTTTAATTACAAAACTTTCTACAGCTGCACGCACTGCTTTAG
AAAAATCTGCTAATGCTTGTGTTCTTCAGCAAAACTACGAAATTGAAATTGAACATTTATTTTTAGAGTT
ACTTAATCAGCCTTTAGAAAACGATTTAAAAATTTTATTAAAAAAATATAAAATCTCAGCCGATGCTTTA
GCAGATGATTTAAAAGAAACAATTTCTCAATTACCAAAAGGTAATACACGTACTCCAATTTTTGCTAAAT
CAATTGTTCGTTTATTTGAACAAGCTTGGTTATTGGCTTCAGCAGAACAAAATCCTGTCATTCGTAGTGG
TCATTTACTGGTTGCATTATTAACTGCACCTGACCTCTATCAAATTGCAACGAGAGCTTCGAGTTTATTC
GATCTTTTCCCGATAGACTCAATGAAACATAAGTTTCTCGAAATTTGTGAAAAAAGTGTAGAACAACAAG
AAGAATCAAAAACATCTTCACAAGCAGATGAATTAGAACAAGCTGTGACTCCAACTGCAAAAACTCAAAA
AACACCTGCTTTAGATCAATATACAATTAATTTAACTGAAAAAGCGAAGAACGGCGGAATTGACCCTGTT
ATTGGGCGTGAATATGAAATTCGTTTGATGCTTGATATTTTAATGCGCAGACGCCAGAACAACCCAATTT
TAACTGGTGAGCCAGGTGTAGGTAAAACAGCTGTAGTTGAAGGGTTGGCTTTAAAAATTGCTCAAGGTTT
AGTTCCTGAGGCATTAAAAAATGTACATTTGCATGTTTTAGATATGGGGCTTTTGCAAGCTGGGGCAAGT
GTTAAAGGTGAATTTGAAAACCGTTTAAAGCAAGTTATTCAAGAAGTCCAATCATCGGCTCATCCTATTA
TTTTATTTATTGATGAAGCGCATACGCTTATTGGAGCAGGTGGCCAAGCGGGGCAAAACGATGCTGCCAA
TCTTTTAAAACCTGCACTTGCTCGTGGCGAGTTACGTACTATTGCTGCAACAACATGGGCAGAATATAAA
CAGTATTTTGAGAAAGATGCTGCATTGAGCCGCCGTTTTCAGGTGGTAAAGGTTGAAGAGCCGACCGAAG
AAGTTGCTGTGGATATGCTACGTGCAATGATTCCCGTAATGCAAAAGCACTTTAATTTACAAATTGATGA
TGAAGCAATTGTAACGGCTGTACATGCCTCTCATCGCTATATTAGTGGTCGTCAACTCCCAGACAAAGCA
GTAAGTGTTCTTGATACTGCAGCAGCGCGTGTAGCTTTGACCCAAAATGCACAACCAGTCAAACTTGATC
AATTAAAAGCACAAGAACATAACTTAAAGCTTGAGCAACAAATTTTGGAAAATGAACACCTTCAGATTCC
AATACATCATGAACGATTAGAAAATCTGAAAAACCAACTAAAGTCATTACAAAGTGAGATCCAAGAGACT
CAGGAACAATGGCAAAAAGAATTAGAGCTAGTTCGTAAAATTCAGGAATTAGAAGCGCAGAGCCATTCTA
ATGAGTCTGAAGCCTACGATCAGATTAATTTAATACGCAAAGACCTTGCTGATATTCAGGGACAACAGCC
GTTAGTTTTTGAGCGAGTAAACTCTCAGATCATCAATGAAATTATTTCTGATTGGACAGGTATTCCTGTT
GGGAAAATGGTCAATGATGAAATTAAGCAGATTTTAACGCTTGAAGATAAATTAGGTGAGCGTGTAATGG
GGCAAGATTATGCACTTACACAATTAGTTCAAGGGATTAAAACTTCAAAAGCTAAATTAGAAGATCCAAA
TAAACCTCAAGGGGTGTTCCTTTTAGTTGGACCTAGTGGGGTTGGTAAAACCGAAACTGCTTTAGCCTTG
GCTAATGAGTTATATGGCGGTGAACAGCATTTAATCACGATTAATATGTCTGAGTATCAAGAAGCACATA
CTGTCTCTTCGCTTAAAGGTGCTCCTCCAGGCTATGTTGGCTATGGTCAGGGTGGGGTTTTAACTGAAGC
TGTACGCCGTAATCCTTATAGTGTTGTGTTACTCGACGAAATTGAAAAAGCACATAGCGATGTTCAGGAA
TTGTTCTATCAAGTATTTGATAAAGGTACTTTAGAGGATGGTGAAGGGCGCGTTATTGATTTTAAAAACA
CGACAATCTTATTAACTTCAAATACGGGCTCGAGTGCAATTATGCAGGCATGTTTAAATCAGCCTGTAGA
AGAATGGCCTACCGCAGAAGATTTAATCGAACATTTAAAGCCGATTTTATATAAACAGTTTAAGCCAGCC
TTTTTAGGGCGTATGAGAGTTGTGCCATATTTCCCATTGCATGATGATTTATTGGTTCGAATTATTAAAC
ATAAATTGGGCAAAATTACTGCTCGAATTGAAAAACAATATGGAACGAAAGTTCAATATTCAGATGACTT
GGTCGAGTTGCTACTCAGCCGTTGTACTGAAGTGGATAGTGGCGCCCGTAATGTTGATAACATCTTAAAT
TCTACAGTTTTACCTGCTTTGGCAACTGAAATTTTAGTGGCGTTAGCAGATCAAAAATTGCCGAAATTGA
TCATGATTGATGCAAAAGATGACGAGATCCAATATTTACTAGATCCTGTGGCGAAGCCTGCTAAAAAACG
GACTAGTAAAAAGTTGAAATCAGAAGTTTAA