SecReT6
Protein ID: 169633790
SecReT6 ID254
T6SS typei4b
Gene symbol-
Locus tagABSDF2241
StrainAcinetobacter baumannii SDF
Repliconchromosome [GenBank: NC_010400] [Browse all T6SS(s) in this replicon]
Location [Strand]2067827..2068090 [-]
Producthypothetical protein
NotePAAR
UniProt IDB0VRP6
KEGG IDabm:ABSDF2241
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 2.20E-21, Aligned region: 8..79
Protein Sequence: 87 a.a.     [Download]
>gi|169633790|ref|YP_001707526.1| hypothetical protein ABSDF2241 [Acinetobacter baumannii SDF]
MASPYIMIGCPTTGGGQVISGNSAFLIEGITIACVGDKATCPAHKTVSTIVSGDPNMQVMGKAAARVNDS
LSCGCKLLPKQSLVNQG
 
Nucleotide Sequence: 264 bp     [Download]
>gi|169632029|ref|NC_010400.1|:c2068090-2067827 Acinetobacter baumannii SDF chromosome, complete genome
ATGGCTAGCCCTTACATTATGATTGGATGCCCAACGACAGGTGGAGGGCAAGTCATTTCTGGTAATAGTG
CATTTTTAATTGAGGGAATCACAATTGCATGTGTAGGTGATAAAGCAACTTGTCCGGCGCATAAAACGGT
TTCTACGATTGTTTCCGGTGACCCAAATATGCAAGTGATGGGAAAAGCAGCAGCAAGAGTAAATGATTCA
TTATCGTGTGGCTGTAAATTATTACCGAAACAAAGTTTGGTTAATCAAGGGTAG