SecReT6
Protein ID: 169633795
SecReT6 ID254
T6SS typei4b
Gene symbol-
Locus tagABSDF2246
StrainAcinetobacter baumannii SDF
Repliconchromosome [GenBank: NC_010400] [Browse all T6SS(s) in this replicon]
Location [Strand]2075138..2076136 [-]
Producthypothetical protein
NoteTssG
UniProt IDB0VRQ1
KEGG IDabm:ABSDF2246
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.50E-62, Aligned region: 18..312
Protein Sequence: 332 a.a.     [Download]
>gi|169633795|ref|YP_001707531.1| hypothetical protein ABSDF2246 [Acinetobacter baumannii SDF]
MQSERWWQDSSVTAELFQRPKSFEFIQATRLLRHMPANDAALSWCDHFKFETSFNLNFPATEIESLELVD
ERVHLTNLIVGLTGIQGTLPYTYTNKIKQAPRQQRAETKEFLSLFNHKLTSQYVESSITYHLPVRYEIEN
KNDYLDILHALNGYVRSQHQQQDLDEYFAEFSGLMQGQNNTVHALKTMLSCIFKHEITIKEFVQESFKLA
GDQLTTLGGSQPSLLGINTFCGETIQQIDGKIEIQIGPLKHQQYLRFLPHQELSLKLKKIVETWCSPTLS
IDLRLILDESEIQPVRLTQGQEGGLGQGAFLMSRKPNTHNDETCYSLIGEQI
 
Nucleotide Sequence: 999 bp     [Download]
>gi|169632029|ref|NC_010400.1|:c2076136-2075138 Acinetobacter baumannii SDF chromosome, complete genome
ATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTGTAACGGCTGAGTTGTTTCAACGCCCTAAGTCTTTTG
AGTTTATTCAAGCAACACGTTTATTGCGTCATATGCCTGCCAATGACGCAGCTTTGTCATGGTGTGACCA
TTTTAAATTTGAGACCTCATTTAACTTAAATTTTCCGGCCACTGAAATTGAAAGTTTAGAGTTAGTAGAT
GAGCGTGTTCATTTAACAAACCTGATCGTTGGTCTTACCGGTATACAAGGTACATTACCTTATACATATA
CAAATAAAATTAAGCAGGCTCCAAGGCAACAACGTGCTGAAACGAAAGAGTTTTTAAGCTTATTTAATCA
TAAGCTGACCAGTCAGTATGTAGAGTCAAGTATTACTTATCACTTGCCTGTGCGCTATGAAATTGAAAAT
AAAAATGATTATTTGGATATTCTTCATGCATTGAATGGCTATGTTCGCTCACAACATCAGCAACAAGACT
TGGATGAATATTTCGCTGAATTTTCAGGCCTAATGCAGGGGCAAAATAATACGGTTCATGCTTTAAAGAC
GATGTTGAGTTGTATTTTTAAGCATGAAATTACAATTAAAGAGTTTGTACAGGAATCGTTTAAGTTAGCG
GGTGATCAGCTAACCACTTTAGGTGGAAGTCAACCGAGCTTACTTGGTATTAACACATTTTGTGGGGAAA
CGATTCAACAAATTGATGGAAAAATTGAGATTCAAATAGGTCCGCTTAAGCATCAGCAATATTTAAGATT
TTTACCTCATCAAGAGCTTAGCTTAAAGCTCAAAAAAATCGTAGAAACCTGGTGCAGTCCAACTTTATCG
ATAGATTTAAGATTGATATTGGATGAGTCTGAAATACAACCTGTTCGCTTAACTCAAGGCCAAGAAGGTG
GCCTAGGACAAGGCGCTTTTTTAATGTCTCGTAAGCCTAATACACATAACGATGAAACATGTTATAGCCT
TATAGGAGAGCAAATATGA