SecReT6
Protein ID: 169633796
SecReT6 ID254
T6SS typei4b
Gene symbol-
Locus tagABSDF2247
StrainAcinetobacter baumannii SDF
Repliconchromosome [GenBank: NC_010400] [Browse all T6SS(s) in this replicon]
Location [Strand]2076100..2077911 [-]
Producthypothetical protein
NoteTssF
UniProt IDB0VRQ2
KEGG IDabm:ABSDF2247
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.20E-155, Aligned region: 5..603
Protein Sequence: 603 a.a.     [Download]
>gi|169633796|ref|YP_001707532.1| hypothetical protein ABSDF2247 [Acinetobacter baumannii SDF]
MIEELLPFYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARIDKKLTDSYDV
FTRSLFEVMFPQYLRHFPACSVVSFEDINKIKQLTEPHLVPHHTVLKSRSFKGVQCEFNTTQDVRLLPIH
LSGLDFKTTPSAHMHLNQNATLSLKFEIFNNAHACLTDEKLPIYLDAISNFPLQVLDSIFKKGTSFAVKY
GQIIVELSKNPFELTGFAEQESLLPLDQHTHHAYRLLMEYFCFPEKFSYLKLDLDFLKRIPQHVSEFELL
IHFKLNLNDQAVVRNYSELNIANFKLFTTPVINLFEKYAEPQKIVHKQLEYPLVTDAHHPEFYQVYSILE
MNMVREKTNQEESYVPVLPFFAMSHYHNDTARFFYSVNYQKLQSNFVEMGYSIISKNLNPFSTRSDFIST
KLLCSNRDLPHEALGQSNNVLNLNDSSLARRAIVLKRPTKPYKFEQGQSEQWRVISHLSLNSLALMKGDA
VSLVKELLALYNLPQSKENYLIIESIKKLEFSLTHKLVDGKPFPMFVRGVKAELQIDSSVFRGHSLYIFS
QLLSRVFNLKVQINSFVDLVVKDYSSQQELYQCSQNVGGKTLL
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|169632029|ref|NC_010400.1|:c2077911-2076100 Acinetobacter baumannii SDF chromosome, complete genome
GTGATAGAAGAGCTTTTACCGTTTTATGAAAAACAATTACAAGAATTTGGTCAACAATCTCGGGAATTTG
CCCAAAAATATCCAAAAATTGCTCAGCGCTTATCTTTAAATCAAGAGCAAATTGATGACCCACATATTGA
ACGTCTGATTCAGGCTTTTTCGCTGATTGCTGCTCGAATCGATAAAAAACTAACAGACAGTTACGATGTT
TTTACTCGTTCTTTATTTGAGGTGATGTTCCCTCAATACTTACGACATTTTCCTGCGTGTTCAGTTGTTA
GCTTTGAAGATATTAATAAGATTAAACAGCTTACAGAACCTCATCTTGTACCTCATCATACGGTTTTGAA
ATCTCGTAGTTTCAAGGGAGTACAGTGTGAGTTTAATACAACTCAAGATGTTAGATTACTGCCTATTCAT
TTAAGTGGTTTAGATTTTAAAACTACACCTAGTGCACATATGCACTTAAATCAAAATGCGACGTTGAGCC
TTAAATTTGAAATTTTTAATAATGCTCATGCTTGTTTAACTGATGAGAAACTTCCTATTTATTTGGATGC
TATCTCTAATTTTCCTCTACAGGTCCTTGATAGTATTTTCAAAAAAGGAACCAGTTTTGCGGTTAAATAT
GGACAAATAATTGTAGAATTGAGCAAGAATCCATTCGAATTGACTGGTTTTGCAGAACAAGAAAGTTTAT
TACCGCTTGATCAACATACCCATCATGCTTATCGTTTGTTGATGGAATACTTTTGTTTCCCGGAAAAGTT
TAGTTATCTTAAGCTCGATTTAGATTTTTTAAAGCGAATACCTCAGCATGTATCCGAATTTGAGCTTTTA
ATTCATTTCAAATTAAACTTAAATGATCAAGCCGTTGTTAGAAACTATTCTGAGCTAAATATTGCAAACT
TTAAATTATTTACTACCCCAGTAATTAATTTATTTGAAAAATATGCTGAACCTCAGAAGATAGTTCACAA
GCAATTAGAATATCCTTTAGTTACAGATGCACATCATCCTGAGTTTTATCAGGTATATTCAATACTTGAG
ATGAATATGGTGCGTGAAAAAACAAATCAGGAAGAAAGCTATGTTCCTGTTTTGCCTTTTTTTGCGATGA
GCCATTACCACAATGATACAGCTCGCTTTTTTTACTCAGTAAACTATCAAAAGTTACAGTCCAATTTCGT
TGAAATGGGCTATTCGATTATTTCTAAAAATTTAAATCCATTTTCAACGCGCTCAGATTTTATTAGTACC
AAATTATTATGTTCAAACCGTGATTTACCTCATGAAGCACTGGGTCAGTCTAATAACGTATTAAATTTAA
ATGATAGTAGCTTGGCGAGACGTGCCATTGTTTTAAAACGACCTACAAAGCCTTATAAGTTTGAACAAGG
CCAAAGTGAACAGTGGCGTGTGATCTCGCATCTTTCATTAAATAGCTTAGCACTTATGAAAGGGGATGCT
GTTTCTCTTGTTAAAGAGCTGCTGGCTTTATATAACTTACCGCAGTCAAAAGAAAATTATTTAATTATAG
AATCAATTAAAAAATTAGAATTTTCGCTTACCCATAAACTTGTAGATGGCAAACCATTTCCAATGTTTGT
AAGAGGAGTGAAAGCTGAATTACAAATTGACTCATCAGTATTTAGAGGGCATAGCTTATATATTTTTAGT
CAGTTATTAAGTCGTGTTTTTAATTTAAAGGTTCAAATTAATAGTTTTGTTGATTTGGTGGTTAAGGATT
ATTCATCTCAGCAGGAGTTATACCAATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTGTAA