SecReT6
Protein ID: 169633797
SecReT6 ID254
T6SS typei4b
Gene symbol-
Locus tagABSDF2248
StrainAcinetobacter baumannii SDF
Repliconchromosome [GenBank: NC_010400] [Browse all T6SS(s) in this replicon]
Location [Strand]2077928..2078404 [-]
Producthypothetical protein
NoteTssE
UniProt IDB0VRQ3
KEGG IDabm:ABSDF2248
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-18, Aligned region: 32..135
Protein Sequence: 158 a.a.     [Download]
>gi|169633797|ref|YP_001707533.1| hypothetical protein ABSDF2248 [Acinetobacter baumannii SDF]
MNLDRLYPYGFRSTLFDRLIPESEDYAKGLSIQQLRESVAKDLEDLLNSRVAKLDHVIDDYPLVKKSILQ
FGIIDFVGLSTANPLDRDKICQSIEQSIAAHEPRLRQIRVEMLLDGHNMGALCLSIQAYLNIHPLYEPVV
FDALLKPTTQQYVISART
 
Nucleotide Sequence: 477 bp     [Download]
>gi|169632029|ref|NC_010400.1|:c2078404-2077928 Acinetobacter baumannii SDF chromosome, complete genome
ATGAACTTAGATCGGCTTTATCCATACGGATTTCGTTCAACTTTATTTGATCGCTTAATTCCAGAAAGTG
AAGATTATGCAAAAGGTCTTTCTATTCAGCAATTAAGAGAATCTGTAGCAAAGGATTTAGAAGATTTGCT
CAATAGTCGGGTAGCAAAGTTAGATCATGTGATTGATGACTATCCACTTGTAAAAAAATCGATACTTCAG
TTCGGGATTATTGATTTTGTGGGGCTTTCTACAGCCAACCCTCTGGATCGGGATAAAATTTGCCAATCCA
TTGAGCAATCAATAGCAGCTCATGAACCTCGGCTAAGACAAATACGGGTAGAGATGTTATTAGATGGACA
TAATATGGGCGCATTATGTTTAAGTATTCAGGCTTATCTAAATATTCACCCCTTATATGAACCTGTTGTA
TTTGATGCATTGTTAAAACCAACAACGCAGCAATATGTAATTTCAGCAAGAACTTAA