SecReT6
Protein ID: 169633799
SecReT6 ID254
T6SS typei4b
Gene symbol-
Locus tagABSDF2250
StrainAcinetobacter baumannii SDF
Repliconchromosome [GenBank: NC_010400] [Browse all T6SS(s) in this replicon]
Location [Strand]2079037..2080533 [-]
Producthypothetical protein
NoteTssC
UniProt IDB0VRQ5
KEGG IDabm:ABSDF2250
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-191, Aligned region: 70..494
Protein Sequence: 498 a.a.     [Download]
>gi|169633799|ref|YP_001707535.1| hypothetical protein ABSDF2250 [Acinetobacter baumannii SDF]
MRRPIMNNTQSAAMPLVENEEVNLLDSIVEQSRIARNEEEHSRAKSLIGELAKEVMAGTITVSENMTLSI
DKRIAEIDALISKQLSQIMHNEQFQKIESTWRGLYYFCQETPSNPLIKIRMLNTTKKELVKDFQGATDFD
QSTLFKKIYEEEYGSFGGAPYSALIGDFEFDRTPSDMYLLEQISHVAAAAHAPFISAASPSILGLESFTD
IDRPRDVSKIFETAEYVQWRSFRDSEDSRYVALTLPHVLGRLPYHPKEGAATEGFNFIEDVSGENHNEYL
WMNAAYAFGTRLTNAFDMHGWCAAIRGVEGGGLVEGLPVHTFKTQDGEVVFKCPTEIAITDRREKELSDL
GFIPLVHCKNTDYAAFFGAQSTQKPKKYDNDTANANSALSSQIQYIMAVSRIAHYLKAMMRDKVGSFTSA
GNVEAFLNEWLSQYVLLDDGASQEAKAQYPLREASVKVVEDPAQPGHYKSVVFLRPHFQLDELSVSLRLV
TELPQSSN
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|169632029|ref|NC_010400.1|:c2080533-2079037 Acinetobacter baumannii SDF chromosome, complete genome
GTGCGGAGGCCGATCATGAATAATACTCAATCAGCAGCAATGCCACTTGTTGAAAATGAAGAAGTTAATC
TTTTAGATTCGATTGTTGAACAAAGCCGTATTGCACGAAATGAAGAAGAACATTCTCGTGCTAAAAGCTT
AATTGGTGAGCTTGCTAAAGAAGTAATGGCAGGGACCATTACTGTTTCTGAAAATATGACTTTATCAATT
GATAAGCGTATTGCAGAAATTGATGCTCTGATTTCAAAGCAGTTAAGTCAGATCATGCATAATGAACAAT
TCCAAAAAATTGAGTCAACTTGGCGTGGTCTTTATTACTTTTGTCAGGAAACGCCTTCAAATCCGCTCAT
TAAAATTCGTATGCTCAATACGACTAAGAAAGAGTTGGTAAAAGATTTCCAAGGTGCTACAGACTTTGAT
CAAAGCACTTTGTTTAAGAAAATCTACGAAGAAGAATACGGTTCTTTTGGTGGTGCACCATACTCGGCAT
TAATTGGTGATTTTGAGTTTGACCGTACTCCATCTGATATGTATTTGCTTGAGCAAATCTCTCATGTTGC
AGCGGCAGCACATGCACCCTTTATTTCAGCTGCTAGTCCGAGCATTTTAGGCCTTGAATCATTTACAGAT
ATTGATCGTCCTAGAGATGTTTCAAAAATCTTTGAAACCGCTGAATATGTTCAATGGCGTTCGTTCCGTG
ATAGTGAAGACTCACGTTATGTTGCATTGACTTTGCCTCATGTCTTGGGTCGTCTCCCATATCATCCAAA
AGAAGGTGCTGCGACAGAAGGCTTTAATTTTATTGAAGATGTTTCTGGTGAAAACCATAATGAATATTTG
TGGATGAATGCAGCTTATGCTTTTGGTACTCGCTTAACAAATGCATTTGATATGCATGGTTGGTGTGCTG
CTATTCGTGGTGTTGAAGGCGGTGGTTTAGTTGAAGGCTTGCCAGTACATACTTTTAAAACACAAGATGG
CGAAGTGGTATTCAAGTGTCCAACTGAAATTGCAATCACGGATCGCCGTGAAAAAGAGTTAAGCGACCTA
GGCTTCATTCCGTTAGTACATTGTAAAAATACAGATTACGCAGCTTTCTTTGGCGCGCAATCAACTCAAA
AACCTAAAAAATATGACAATGATACAGCCAATGCAAACTCGGCTTTATCAAGTCAGATTCAGTACATCAT
GGCTGTTTCACGTATTGCACATTACTTAAAAGCAATGATGCGAGATAAAGTGGGTAGCTTTACTTCTGCT
GGAAATGTTGAAGCATTTTTAAATGAGTGGTTGTCACAGTATGTCCTACTTGACGATGGTGCTTCTCAAG
AAGCAAAAGCTCAATACCCGTTACGTGAAGCATCTGTAAAAGTTGTAGAAGATCCTGCTCAACCAGGTCA
CTACAAATCTGTGGTTTTCTTGCGACCACATTTCCAGCTGGATGAGTTGTCGGTTTCTTTACGACTTGTC
ACTGAGTTACCTCAGTCCTCAAATTAA