SecReT6
Protein ID: 169656485
SecReT6 ID474
T6SS typeii
Gene symbol-
Locus tagFTA_0129
StrainFrancisella tularensis subsp. holarctica FTNF002-00
Repliconchromosome [GenBank: NC_009749] [Browse all T6SS(s) in this replicon]
Location [Strand]115156..115677 [-]
Producthypothetical protein
NoteIglG
UniProt IDA7N9F4
KEGG IDfta:FTA_1230, fta:FTA_0129
PDB IDNA
Domain hit(s) vs Pfam DUF4280 [PF14107], Evalue: 1.10E-16, Aligned region: 58..167
Protein Sequence: 173 a.a.     [Download]
>gi|169656485|ref|YP_001427563.2| hypothetical protein FTA_0129 [Francisella tularensis subsp. holarctica FTNF002-00]
MLNIINDSLKRLKEITTNDESISSSVSDLVADLNNIKILLAQSKLHLSSNASILTTSMGAQIKCSYSLGS
GIYLSTRIKTLTNNLPASNITDSKLGANILPFAGCTNPANPTMNPFSFPWVCIPNLSAFIPTNPTTLLEN
APITTINSKAMCMFAPGGIVDFISSGQINVKTS
 
Nucleotide Sequence: 522 bp     [Download]
>gi|156501369|ref|NC_009749.1|:c115677-115156 Francisella tularensis subsp. holarctica FTNF002-00 chromosome, complete genome
ATGTTAAATATTATAAATGACTCCTTAAAACGCTTGAAAGAAATAACGACCAATGATGAAAGTATTAGTA
GCTCAGTATCTGATCTAGTGGCGGATTTAAACAATATAAAAATTTTATTAGCTCAATCAAAACTACACTT
ATCAAGCAATGCGTCAATATTAACCACATCAATGGGAGCACAAATTAAATGCTCATATAGTCTTGGATCA
GGAATTTATCTTAGTACAAGAATAAAAACACTAACGAACAACTTACCAGCTTCAAATATTACCGATTCTA
AACTAGGAGCTAACATTTTACCTTTTGCTGGATGTACAAATCCAGCAAACCCTACAATGAACCCATTTAG
CTTTCCTTGGGTATGTATACCAAACTTATCTGCTTTTATCCCCACGAACCCTACTACGCTACTGGAAAAT
GCTCCTATAACTACAATAAATAGTAAAGCAATGTGTATGTTTGCTCCGGGTGGTATAGTTGATTTTATTA
GTAGTGGACAAATAAATGTAAAAACATCTTAG