SecReT6
Protein ID: 169656631
SecReT6 ID475
T6SS typeii
Gene symbol-
Locus tagFTA_1230
StrainFrancisella tularensis subsp. holarctica FTNF002-00
Repliconchromosome [GenBank: NC_009749] [Browse all T6SS(s) in this replicon]
Location [Strand]1110462..1110983 [-]
Producthypothetical protein
NoteIglG
UniProt IDA7N9F4
KEGG IDfta:FTA_1230, fta:FTA_0129
PDB IDNA
Domain hit(s) vs Pfam DUF4280 [PF14107], Evalue: 1.10E-16, Aligned region: 58..167
Protein Sequence: 173 a.a.     [Download]
>gi|169656631|ref|YP_001428662.2| hypothetical protein FTA_1230 [Francisella tularensis subsp. holarctica FTNF002-00]
MLNIINDSLKRLKEITTNDESISSSVSDLVADLNNIKILLAQSKLHLSSNASILTTSMGAQIKCSYSLGS
GIYLSTRIKTLTNNLPASNITDSKLGANILPFAGCTNPANPTMNPFSFPWVCIPNLSAFIPTNPTTLLEN
APITTINSKAMCMFAPGGIVDFISSGQINVKTS
 
Nucleotide Sequence: 522 bp     [Download]
>gi|156501369|ref|NC_009749.1|:c1110983-1110462 Francisella tularensis subsp. holarctica FTNF002-00 chromosome, complete genome
ATGTTAAATATTATAAATGACTCCTTAAAACGCTTGAAAGAAATAACGACCAATGATGAAAGTATTAGTA
GCTCAGTATCTGATCTAGTGGCGGATTTAAACAATATAAAAATTTTATTAGCTCAATCAAAACTACACTT
ATCAAGCAATGCGTCAATATTAACCACATCAATGGGAGCACAAATTAAATGCTCATATAGTCTTGGATCA
GGAATTTATCTTAGTACAAGAATAAAAACACTAACGAACAACTTACCAGCTTCAAATATTACCGATTCTA
AACTAGGAGCTAACATTTTACCTTTTGCTGGATGTACAAATCCAGCAAACCCTACAATGAACCCATTTAG
CTTTCCTTGGGTATGTATACCAAACTTATCTGCTTTTATCCCCACGAACCCTACTACGCTACTGGAAAAT
GCTCCTATAACTACAATAAATAGTAAAGCAATGTGTATGTTTGCTCCGGGTGGTATAGTTGATTTTATTA
GTAGTGGACAAATAAATGTAAAAACATCTTAG