SecReT6
Protein ID: 169796441
SecReT6 ID255
T6SS typei4b
Gene symbol-
Locus tagABAYE2402
StrainAcinetobacter baumannii AYE
Repliconchromosome [GenBank: NC_010410] [Browse all T6SS(s) in this replicon]
Location [Strand]2445213..2446577 [-]
Producthypothetical protein
NoteTssK
UniProt IDB0VB15
KEGG IDaby:ABAYE2402
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.50E-126, Aligned region: 19..451
Protein Sequence: 454 a.a.     [Download]
>gi|169796441|ref|YP_001714234.1| hypothetical protein ABAYE2402 [Acinetobacter baumannii AYE]
MFKAEKVLWGEGLFLRPQHFQIQDTYHEQRLNHTVRAVVPFSYGVQKLSFDEAQLSTHILALESVEMIWQ
DGEIYQAPAYDLLPEPILLDELNLRGEMVIYLALPLLQANKQNLIDQNQSQKGRYQSHLVETHDLFTNAT
EADISLLRRRAVFKLLDAHSNPDHNLDGFLYLPIGKIKRQSSGAFEIDRKFIPPILHVDASETLVSNLKR
TLNVIKAKIKTIQTNNRENEQKLIEFRSGDIVSFWLVNALNTAHAGLSHFLQYPQIHPERLFFELLRLAG
SLLTFSTAYEVDQLPAYKHHNLQESFTQLDTILRDLLDTIISSRYISIALKEIRPSYWVGSLETDKITRD
TRLYIAVSSSAMQTHELIQIVPLRFKIGSTLDVEQRVVAALPAIPLHHLIQVPTAIPVRSGVSYFEIEPH
HELYQRMLDSETICIYVPAGFQDISIELIAVMNA
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|169794206|ref|NC_010410.1|:c2446577-2445213 Acinetobacter baumannii AYE chromosome, complete genome
ATGTTTAAAGCTGAAAAAGTCCTGTGGGGCGAAGGTCTATTTTTAAGACCTCAACATTTCCAGATTCAAG
ATACCTATCATGAACAACGTTTAAATCATACGGTTCGTGCTGTTGTGCCATTTTCCTATGGCGTTCAAAA
ACTTAGTTTTGATGAAGCACAGCTAAGTACGCATATTCTTGCACTTGAATCGGTAGAAATGATTTGGCAA
GACGGTGAAATATATCAAGCGCCTGCTTATGACTTATTACCTGAACCTATTTTGCTTGATGAGCTTAATT
TACGTGGTGAAATGGTCATCTATTTGGCATTACCATTATTACAAGCCAATAAACAAAATTTAATCGATCA
AAATCAATCACAAAAGGGGCGCTATCAATCACATTTGGTTGAGACCCACGATCTGTTCACAAACGCGACA
GAAGCTGATATCAGCTTATTACGTCGTCGAGCTGTGTTTAAATTATTAGATGCACATAGTAATCCTGATC
ATAATTTAGATGGTTTCCTGTATTTGCCAATAGGCAAAATTAAACGTCAGAGTTCAGGTGCTTTCGAAAT
TGACCGCAAATTTATTCCGCCCATTTTGCATGTTGATGCATCTGAGACCTTAGTTTCAAATTTAAAAAGA
ACCTTGAATGTTATTAAGGCAAAAATTAAAACGATTCAAACCAATAACCGAGAAAATGAGCAGAAATTAA
TTGAATTCCGTTCAGGTGATATCGTTTCGTTTTGGTTGGTAAATGCTTTAAATACTGCTCATGCTGGTCT
GAGCCATTTCTTGCAATATCCGCAAATTCATCCGGAACGCTTATTCTTTGAATTGCTACGTTTGGCAGGT
TCATTATTAACTTTCTCGACAGCTTATGAAGTTGATCAGTTGCCTGCATATAAACATCATAATTTGCAAG
AGAGCTTCACCCAGCTCGACACAATTTTACGTGATTTACTCGATACGATTATTTCGAGTCGTTACATCAG
TATTGCCCTTAAAGAAATTCGCCCTTCATATTGGGTGGGAAGTCTCGAAACCGATAAGATTACTCGAGAT
ACCAGACTTTATATTGCTGTATCAAGTAGCGCGATGCAGACCCACGAGTTGATTCAAATCGTTCCTCTAC
GTTTTAAAATCGGTAGTACTTTAGATGTTGAACAACGTGTTGTTGCAGCATTACCAGCAATTCCATTACA
TCACTTAATCCAAGTTCCAACTGCTATTCCAGTACGTTCGGGTGTGAGCTATTTTGAAATCGAACCGCAT
CATGAACTCTATCAACGTATGTTGGATTCAGAAACGATTTGTATTTATGTTCCGGCTGGATTCCAAGATA
TCAGTATTGAGCTGATTGCGGTCATGAACGCTTAA