SecReT6
Protein ID: 169796443
SecReT6 ID255
T6SS typei4b
Gene symbol-
Locus tagABAYE2404
StrainAcinetobacter baumannii AYE
Repliconchromosome [GenBank: NC_010410] [Browse all T6SS(s) in this replicon]
Location [Strand]2447712..2450402 [-]
ProductClpA/B-type chaperone
NoteTssH
UniProt IDB0VB17
KEGG IDaby:ABAYE2404
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.40E-44, Aligned region: 232..310
AAA_2 [PF07724], Evalue: 8.40E-44, Aligned region: 609..777
AAA [PF00004], Evalue: 1.50E-23, Aligned region: 233..346
AAA [PF00004], Evalue: 1.50E-23, Aligned region: 614..732
AAA_5 [PF07728], Evalue: 5.80E-14, Aligned region: 233..255
AAA_5 [PF07728], Evalue: 5.80E-14, Aligned region: 613..734
ClpB_D2-small [PF10431], Evalue: 4.80E-13, Aligned region: 387..400
ClpB_D2-small [PF10431], Evalue: 4.80E-13, Aligned region: 783..853
AAA_16 [PF13191], Evalue: 3.90E-12, Aligned region: 13..76
AAA_16 [PF13191], Evalue: 3.90E-12, Aligned region: 210..255
AAA_16 [PF13191], Evalue: 3.90E-12, Aligned region: 277..312
AAA_16 [PF13191], Evalue: 3.90E-12, Aligned region: 480..519
AAA_16 [PF13191], Evalue: 3.90E-12, Aligned region: 608..657
AAA_16 [PF13191], Evalue: 3.90E-12, Aligned region: 679..707
AAA_22 [PF13401], Evalue: 5.80E-09, Aligned region: 232..326
AAA_22 [PF13401], Evalue: 5.80E-09, Aligned region: 462..506
AAA_22 [PF13401], Evalue: 5.80E-09, Aligned region: 610..640
Sigma54_activat [PF00158], Evalue: 8.90E-08, Aligned region: 230..251
Sigma54_activat [PF00158], Evalue: 8.90E-08, Aligned region: 610..720
AAA_19 [PF13245], Evalue: 1.10E-07, Aligned region: 233..253
AAA_19 [PF13245], Evalue: 1.10E-07, Aligned region: 609..635
AAA_25 [PF13481], Evalue: 2.70E-07, Aligned region: 233..305
AAA_25 [PF13481], Evalue: 2.70E-07, Aligned region: 609..640
AAA_25 [PF13481], Evalue: 2.70E-07, Aligned region: 836..868
AAA_14 [PF13173], Evalue: 4.60E-07, Aligned region: 233..336
AAA_14 [PF13173], Evalue: 4.60E-07, Aligned region: 611..696
AAA_17 [PF13207], Evalue: 1.10E-06, Aligned region: 233..280
AAA_17 [PF13207], Evalue: 1.10E-06, Aligned region: 612..650
IstB_IS21 [PF01695], Evalue: 1.50E-06, Aligned region: 227..293
IstB_IS21 [PF01695], Evalue: 1.50E-06, Aligned region: 613..633
NACHT [PF05729], Evalue: 4.10E-06, Aligned region: 233..331
NACHT [PF05729], Evalue: 4.10E-06, Aligned region: 613..652
AAA_18 [PF13238], Evalue: 7.30E-06, Aligned region: 233..263
AAA_18 [PF13238], Evalue: 7.30E-06, Aligned region: 481..544
AAA_18 [PF13238], Evalue: 7.30E-06, Aligned region: 614..643
Arch_ATPase [PF01637], Evalue: 1.20E-05, Aligned region: 66..107
Arch_ATPase [PF01637], Evalue: 1.20E-05, Aligned region: 212..246
Arch_ATPase [PF01637], Evalue: 1.20E-05, Aligned region: 285..382
Arch_ATPase [PF01637], Evalue: 1.20E-05, Aligned region: 474..494
Arch_ATPase [PF01637], Evalue: 1.20E-05, Aligned region: 609..659
Zeta_toxin [PF06414], Evalue: 1.90E-05, Aligned region: 233..253
Zeta_toxin [PF06414], Evalue: 1.90E-05, Aligned region: 608..653
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 232..251
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 303..313
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 577..635
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 682..708
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 225..249
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 608..637
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 717..737
T2SE [PF00437], Evalue: 0.00088, Aligned region: 218..252
T2SE [PF00437], Evalue: 0.00088, Aligned region: 426..461
T2SE [PF00437], Evalue: 0.00088, Aligned region: 585..682
RNA_helicase [PF00910], Evalue: 0.00094, Aligned region: 234..257
RNA_helicase [PF00910], Evalue: 0.00094, Aligned region: 614..635
AAA_28 [PF13521], Evalue: 0.0016, Aligned region: 233..270
AAA_28 [PF13521], Evalue: 0.0016, Aligned region: 613..636
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 228..253
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 592..636
AAA_33 [PF13671], Evalue: 0.0039, Aligned region: 234..305
AAA_33 [PF13671], Evalue: 0.0039, Aligned region: 612..634
TIP49 [PF06068], Evalue: 0.0042, Aligned region: 233..256
TIP49 [PF06068], Evalue: 0.0042, Aligned region: 281..313
TIP49 [PF06068], Evalue: 0.0042, Aligned region: 613..648
NTPase_1 [PF03266], Evalue: 0.0042, Aligned region: 233..253
NTPase_1 [PF03266], Evalue: 0.0042, Aligned region: 284..309
NTPase_1 [PF03266], Evalue: 0.0042, Aligned region: 613..634
Atg14 [PF10186], Evalue: 0.0052, Aligned region: 441..523
DUF2075 [PF09848], Evalue: 0.0063, Aligned region: 233..335
DUF2075 [PF09848], Evalue: 0.0063, Aligned region: 388..510
DUF2075 [PF09848], Evalue: 0.0063, Aligned region: 612..644
MobB [PF03205], Evalue: 0.0065, Aligned region: 234..267
MobB [PF03205], Evalue: 0.0065, Aligned region: 612..643
Clp_N [PF02861], Evalue: 0.0074, Aligned region: 35..77
Clp_N [PF02861], Evalue: 0.0074, Aligned region: 105..135
Protein Sequence: 896 a.a.     [Download]
>gi|169796443|ref|YP_001714236.1| ClpA/B-type chaperone [Acinetobacter baumannii AYE]
MRVMMSSLKILITKLSTAARTALEKSANACVLQQNYEIEIEHLFLELLNQPLENDLKILLKKYKISADAL
ADDLKETISQLPKGNTRTPIFAKSIVRLFEQAWLLASAEQNPVIRSGHLLVALLTAPDLYQIATRASSLF
DLFPIDSMKHKFLEICEKSVEQQEESKTSSQADELEQAATPTAKTQKTPALDQYTINLTEKAKNGGIDPV
IGREYEIRLMLDILMRRRQNNPILTGEPGVGKTAVVEGLALKIAQGLVPEALKNVHLHVLDMGLLQAGAS
VKGEFENRLKQVIQEVQSSAHPIILFIDEAHTLIGAGGQAGQNDAANLLKPALARGELRTIAATTWAEYK
QYFEKDAALSRRFQVVKVEEPTEEVAVDMLRAMIPVMQKHFNLQIDDEAIVTAVHASHRYISGRQLPDKA
VSVLDTAAARVALTQNAQPVKLDQLKAQEHNLKLEQQILENEHRQIPIHHERLENLKNQLESLQSEIQET
QEQWQKELELVRKIQELEAQSHSNESEAYDQINLIRKDLADIQGQQPLVFERVNSQIINEIISDWTGIPV
GKMVNDEIKQILTLEDKLGERVMGQDYALTQLVQGIKTSKAKLEDPNKPQGVFLLVGPSGVGKTETALAL
ANELYGGEQHLITINMSEYQEAHTVSSLKGAPPGYVGYGQGGVLTEAVRRNPYSVVLLDEIEKAHSDVQE
LFYQVFDKGTLEDGEGRVIDFKNTTILLTSNTGSSAIMQACLNQPVEEWPTAEDLIEHLKPSLYKQFKPA
FLGRMRIVPYFPLHDDLLVRIIKHKLGKITARIEKQYGTEVQYSDDLVELLLSRCTEVDSGARNVDNILN
STVLPALATEILVALADQKLPKLIMIDAKDDEIQYLLDPVAKPAKKRTSKKLKSEV
 
Nucleotide Sequence: 2691 bp     [Download]
>gi|169794206|ref|NC_010410.1|:c2450402-2447712 Acinetobacter baumannii AYE chromosome, complete genome
TTGAGAGTAATGATGAGTAGTTTAAAAATTTTAATTACAAAACTTTCTACAGCTGCACGCACTGCTTTAG
AAAAATCTGCTAATGCTTGTGTTCTTCAGCAAAACTACGAAATTGAAATTGAACATTTATTTTTAGAGTT
ACTTAATCAGCCTTTAGAAAACGATTTAAAAATTTTATTAAAAAAATATAAAATCTCAGCCGATGCTTTA
GCAGATGATTTAAAAGAAACAATTTCTCAATTACCAAAAGGTAATACACGTACTCCAATTTTTGCTAAAT
CAATTGTTCGTTTATTTGAACAAGCTTGGTTATTGGCTTCAGCAGAACAAAATCCTGTCATTCGTAGTGG
TCATTTACTGGTTGCATTATTAACTGCACCAGACCTCTATCAAATTGCAACGAGAGCTTCGAGTTTATTT
GATCTTTTCCCGATAGACTCAATGAAACATAAGTTTCTTGAAATTTGTGAAAAAAGTGTAGAACAACAAG
AAGAATCAAAAACATCTTCACAAGCAGATGAATTAGAACAAGCCGCGACTCCAACTGCAAAAACTCAAAA
AACACCTGCTTTAGATCAATATACAATTAATTTAACTGAAAAAGCGAAGAATGGTGGGATTGACCCTGTT
ATTGGGCGTGAATATGAAATTCGTTTGATGCTTGATATTTTAATGCGCAGACGCCAGAACAACCCAATTT
TAACTGGTGAGCCAGGTGTAGGTAAAACAGCTGTAGTTGAAGGGTTAGCTTTAAAAATTGCTCAAGGTTT
AGTTCCTGAGGCATTAAAAAATGTACATTTGCATGTTTTAGATATGGGGCTTTTGCAAGCTGGGGCAAGT
GTTAAAGGTGAATTTGAAAACCGTTTAAAGCAAGTTATTCAAGAAGTCCAATCATCGGCTCATCCTATTA
TTTTATTTATTGATGAAGCGCATACGCTTATTGGAGCAGGTGGCCAAGCGGGGCAAAACGATGCTGCCAA
TCTTTTAAAACCTGCACTTGCTCGTGGCGAGTTACGTACTATTGCTGCAACAACATGGGCAGAATATAAA
CAGTATTTTGAGAAAGATGCTGCATTGAGCCGCCGTTTTCAGGTGGTAAAGGTTGAAGAACCGACCGAAG
AAGTTGCTGTGGATATGCTACGTGCAATGATTCCCGTAATGCAAAAGCACTTTAATTTACAAATTGATGA
TGAAGCAATTGTAACGGCTGTACATGCCTCTCATCGCTATATTAGTGGTCGTCAGCTCCCAGACAAAGCA
GTAAGTGTTCTTGATACTGCAGCAGCGCGTGTAGCTTTGACCCAAAATGCACAACCAGTCAAACTTGATC
AATTGAAAGCACAAGAACATAACTTAAAGCTTGAGCAACAAATTTTGGAAAATGAACACCGTCAAATTCC
AATACATCATGAAAGATTAGAAAATCTGAAAAACCAACTAGAGTCATTACAAAGTGAGATCCAAGAGACT
CAGGAACAATGGCAAAAAGAATTAGAGCTAGTTCGTAAAATTCAGGAATTAGAAGCGCAGAGCCATTCTA
ATGAGTCTGAAGCCTACGATCAGATTAATTTAATACGCAAAGACCTTGCTGATATTCAGGGACAACAGCC
GTTAGTTTTTGAGCGAGTAAACTCTCAGATTATCAATGAAATTATTTCTGATTGGACAGGTATTCCTGTT
GGGAAAATGGTCAATGATGAAATTAAGCAGATTTTAACGCTTGAAGATAAATTAGGTGAGCGTGTAATGG
GGCAAGATTATGCACTTACACAATTAGTTCAAGGGATTAAAACTTCAAAAGCTAAATTAGAAGATCCAAA
TAAACCTCAAGGGGTGTTCCTTTTAGTCGGGCCTAGTGGGGTTGGTAAAACTGAAACTGCTTTAGCCTTA
GCTAATGAGTTATATGGCGGTGAACAGCATTTAATCACGATTAATATGTCTGAGTATCAAGAAGCACATA
CTGTCTCTTCGCTTAAAGGTGCACCTCCAGGCTATGTGGGCTATGGTCAGGGTGGGGTTTTAACTGAAGC
TGTACGCCGTAATCCTTATAGTGTTGTGTTACTCGACGAAATTGAAAAAGCACATAGCGATGTTCAGGAG
TTGTTCTATCAAGTATTTGATAAAGGTACTTTAGAGGATGGTGAAGGGCGCGTTATTGACTTTAAAAACA
CGACAATCTTATTAACTTCAAATACGGGCTCGAGTGCAATTATGCAGGCATGTTTAAATCAGCCTGTAGA
AGAATGGCCTACCGCAGAAGATTTAATCGAACATTTAAAGCCGAGTTTATATAAACAGTTTAAGCCAGCC
TTCTTAGGGCGCATGAGAATTGTGCCATATTTCCCATTGCATGATGATTTATTGGTTCGAATTATTAAAC
ATAAATTGGGCAAAATTACTGCTCGAATTGAAAAACAATATGGAACGGAAGTTCAATATTCAGATGACTT
GGTCGAGTTGCTACTCAGCCGTTGTACTGAAGTGGATAGTGGCGCCCGTAATGTTGATAACATCTTAAAT
TCTACAGTTTTACCTGCTTTGGCAACTGAAATTTTAGTGGCGTTAGCAGATCAAAAATTGCCGAAATTGA
TCATGATTGATGCAAAAGATGACGAGATCCAATATTTACTAGATCCTGTGGCGAAGCCTGCTAAAAAACG
GACTAGTAAAAAGTTGAAATCAGAAGTTTAA