SecReT6
Protein ID: 169796453
SecReT6 ID255
T6SS typei4b
Gene symbol-
Locus tagABAYE2414
StrainAcinetobacter baumannii AYE
Repliconchromosome [GenBank: NC_010410] [Browse all T6SS(s) in this replicon]
Location [Strand]2461822..2463318 [-]
Producthypothetical protein
NoteTssC
UniProt IDB0VB04
KEGG IDaby:ABAYE2414
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.90E-192, Aligned region: 70..494
Protein Sequence: 498 a.a.     [Download]
>gi|169796453|ref|YP_001714246.1| hypothetical protein ABAYE2414 [Acinetobacter baumannii AYE]
MRRPIMNNTQSAAMPLVENEEVNLLDSIVEQSRIARNEEEHSRAKSLIGELAKEVMAGTITVSENMTLSI
DKRIAEIDALISKQLSQIMHNEQFQKIESTWRGLYYFCQETPSNPLIKIRMLNTTKKELVKDFQGATDFD
QSTLFKKIYEEEYGSFGGAPYSALIGDFEFDRTPSDMYLLEQISHVAAAAHAPFISAASPSILGLESFTD
IDRPRDVSKIFETAEYVQWRSFRDSEDSRYVALTLPHVLGRLPYHPKEGTATEGFNFIEDVSGENHNEYL
WMNAAYAFGTRLTNAFDMHGWCAAIRGVEGGGLVEGLPVHTFKTQDGEVVFKCPTEIAITDRREKELSDL
GFIPLVHCKNTDYAAFFGAQSTQKPKKYDNDTANANSALSSQIQYIMAVSRIAHYLKAMMRDKVGSFASA
GNVEAFLNEWLSQYVLLDDGASQEAKAQYPLREASVKVVEDPAQPGHYKSVVFLRPHFQLDELSVSLRLV
TELPQSSN
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|169794206|ref|NC_010410.1|:c2463318-2461822 Acinetobacter baumannii AYE chromosome, complete genome
GTGCGGAGGCCGATCATGAATAATACTCAATCAGCAGCAATGCCACTTGTTGAAAATGAAGAAGTTAATC
TTTTGGATTCGATTGTTGAACAAAGCCGTATTGCACGAAATGAAGAAGAACATTCTCGTGCTAAAAGCTT
AATTGGTGAGCTCGCTAAAGAAGTAATGGCAGGGACCATTACTGTTTCTGAAAATATGACTTTATCAATC
GATAAGCGTATTGCAGAAATTGATGCTCTGATTTCAAAGCAGTTAAGTCAGATCATGCACAATGAACAAT
TCCAAAAAATTGAGTCAACTTGGCGTGGTCTTTATTACTTTTGTCAGGAAACGCCTTCAAATCCGCTCAT
TAAAATTCGTATGCTCAATACGACTAAGAAAGAGTTGGTAAAAGATTTCCAAGGTGCTACAGACTTTGAT
CAAAGCACTTTGTTTAAGAAAATCTACGAAGAAGAATACGGTTCTTTTGGTGGTGCACCATACTCAGCAT
TAATTGGTGATTTTGAGTTTGACCGTACTCCATCTGATATGTATTTGCTTGAGCAAATCTCTCATGTTGC
AGCGGCAGCACATGCACCCTTTATTTCAGCTGCTAGTCCGAGCATTTTAGGCCTTGAATCATTTACAGAT
ATTGATCGTCCTAGAGATGTTTCAAAAATCTTTGAAACCGCTGAATATGTTCAATGGCGTTCGTTCCGTG
ATAGTGAAGACTCCCGTTATGTTGCATTGACTTTGCCTCATGTCTTGGGTCGTCTCCCATATCATCCAAA
AGAAGGTACTGCGACAGAAGGCTTTAATTTTATTGAAGATGTTTCTGGTGAAAACCACAATGAATATTTG
TGGATGAATGCAGCTTATGCTTTTGGTACTCGCTTAACAAATGCATTTGATATGCATGGTTGGTGTGCTG
CTATTCGCGGTGTTGAAGGTGGTGGTTTAGTTGAAGGCTTGCCAGTACATACTTTTAAAACACAAGATGG
CGAAGTGGTATTCAAGTGTCCAACTGAAATTGCAATCACGGATCGCCGTGAAAAAGAGTTAAGCGATCTA
GGTTTCATTCCGTTAGTACATTGTAAAAATACAGATTACGCAGCTTTCTTTGGCGCGCAATCAACTCAAA
AACCTAAAAAATATGACAATGATACAGCCAATGCAAACTCGGCTTTATCAAGTCAGATTCAGTACATCAT
GGCTGTTTCACGTATTGCACATTACTTAAAAGCAATGATGCGAGATAAAGTGGGTAGCTTTGCTTCTGCT
GGAAATGTTGAAGCATTCTTAAATGAGTGGTTGTCACAGTATGTCTTACTTGACGATGGTGCTTCTCAAG
AAGCAAAAGCTCAATACCCGTTACGTGAAGCGTCTGTAAAAGTTGTAGAAGATCCTGCTCAACCAGGTCA
CTACAAATCTGTGGTTTTCTTGCGACCACATTTCCAGCTGGATGAGTTGTCGGTTTCTTTACGACTTGTC
ACTGAGTTACCTCAGTCCTCAAATTAA