SecReT6
Protein ID: 169796454
SecReT6 ID255
T6SS typei4b
Gene symbol-
Locus tagABAYE2415
StrainAcinetobacter baumannii AYE
Repliconchromosome [GenBank: NC_010410] [Browse all T6SS(s) in this replicon]
Location [Strand]2463296..2463799 [-]
Producthypothetical protein
NoteTssB
UniProt IDB0VB05
KEGG IDaby:ABAYE2415
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-58, Aligned region: 11..166
Protein Sequence: 167 a.a.     [Download]
>gi|169796454|ref|YP_001714247.1| hypothetical protein ABAYE2415 [Acinetobacter baumannii AYE]
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDKKFINVDLDNI
DEVMESLSPRAAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPLKKLVEARERLTDLRNKISNS
ERLEDLLDEVLKNTDQIRKLSAEADHE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|169794206|ref|NC_010410.1|:c2463799-2463296 Acinetobacter baumannii AYE chromosome, complete genome
ATGGCTAAGAGAGAAAGCGTACAAAAGAAGCTTCAGCGAATTCGACCTCCACGTGTTCAGCTTACATATG
ATGTCGAAATTGGTGATGCGAAAGAAGCGAAAGAACTACCATTCGTTGTAGGTGTAATGGGTGATTTTTC
AGCTGCATCTGAGCTTGAGCGTACAAAATTAAAAGATAAAAAATTCATTAATGTCGATTTAGATAATATT
GATGAAGTAATGGAATCTCTGTCTCCAAGAGCTGCTTTTCAAGTAGACAATACGTTGACAGAAGAAGGCG
GTAAAATGGCTGTTGATTTAACGTTTAAGTCAATGGAAGATTTTCGCCCGGAAAATGTTGTACAGCAAGT
TGATCCATTAAAGAAATTGGTTGAGGCGCGTGAGCGTTTAACCGATTTAAGAAACAAAATTTCAAACAGT
GAGCGTTTAGAAGACCTGCTTGATGAGGTTCTTAAAAATACTGATCAAATCCGTAAATTAAGTGCGGAGG
CCGATCATGAATAA