SecReT6
Protein ID: 170023048
SecReT6 ID257
T6SS typei2
Gene symbol-
Locus tagYPK_0799
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]907333..908877 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB1JN17
KEGG IDypy:YPK_0799
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.10E-177, Aligned region: 14..51
DUF877 [PF05943], Evalue: 4.10E-177, Aligned region: 90..510
Protein Sequence: 514 a.a.     [Download]
>gi|170023048|ref|YP_001719553.1| EvpB family type VI secretion protein [Yersinia pseudotuberculosis YPIII]
MSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIEAFQNNDALAEATTDERVTAAVSVFL
DLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLDAVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIELL
DISKDHLVQDFEDAPEISQSGLYAQTYIQEYDTPGGEPIAAAISNYEFDRSPQDIALLRNVSKVAAAAHM
PFIGSVGPAFFGKENMEEVAAIKDIGNYFDRAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVPVR
SFNYVEQVKGPDHERYLWTNASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYDLGTGNQVKIP
SEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKLIQRENIGTTKDRRLLELELNNWVRGLVTEMTDPGDDLQASHPLRDAKVTVEDIEDNPGFFRVKLYA
VPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|170022262|ref|NC_010465.1|:907333-908877 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGTCTGTACAGGAAAACCGTGCGCAGGGTACTGCGACGACCGTATTAAAGAATAGCCCTGCGGCACAAG
GGGTTTACGCCGCCTTGTTTGAAAAAATCAACCTGAGCCCGGTCTCCTCACTGGCCGGTATCGAGGCGTT
CCAGAACAACGATGCGCTGGCGGAAGCCACCACCGATGAGCGCGTTACCGCCGCCGTCAGTGTCTTTTTA
GACCTGCTGAAGCAGTCGGCGAAGAAAGTAGAAAAACTGGATAAAACCCTGCTGGACGGCCATATTGCCG
CACTGGATGACCAAATCAGCCGCCAGTTGGACGCGGTAATGCACCACCCCGATTTCCAGCGGGTGGAATC
GACCTGGCGTGGTGTGAAGTCGCTGATCGATCAGACCGATTTCCGCCAGAACGTGCGCATCGAGCTGCTG
GATATCAGTAAAGATCATCTGGTGCAGGATTTTGAAGATGCCCCAGAAATTTCACAAAGCGGTTTATACG
CCCAGACCTATATTCAGGAATACGACACCCCCGGCGGTGAACCGATTGCCGCCGCTATCTCCAACTACGA
GTTCGACCGCAGCCCGCAGGATATCGCCTTATTGCGCAATGTCTCCAAAGTGGCGGCTGCAGCCCATATG
CCGTTTATCGGCTCAGTGGGTCCGGCGTTCTTTGGTAAAGAGAACATGGAAGAGGTGGCGGCCATCAAAG
ATATCGGCAACTACTTTGACCGTGCCGAATACATCAAATGGAAAGCCTTCCGCGACTCGGATGATTCCCG
CTATATCGGCCTGACCATGCCGCGCGTGCTGGGGCGTTTGCCTTATGGGCCAGACACCGTGCCGGTGCGC
AGCTTTAACTACGTAGAGCAGGTGAAAGGGCCGGATCATGAGCGTTATCTGTGGACCAACGCTTCGTTTG
CCTTTGCTGCCAACATGGTGAAAAGCTTCATTAAAAATGGCTGGTGTGTGCAGATCCGTGGCCCGCAGGC
CGGTGGTGCGGTCACCAACTTACCGATCCACCTGTACGATCTGGGTACCGGTAATCAGGTCAAAATTCCG
TCAGAAGTGATGATCCCGGAAACCCGCGAGTTCGAGTTTGCCAATCTGGGCTTTATCCCGCTGTCGTACT
ACAAAAACCGCGATTACTCGTGCTTCTTCTCGGCCAACTCGGCGCAGAAACCGGCGCTGTATGACACCGC
GGATGCCACGGCCAACAGCCGCATCAACGCCCGTCTGCCGTATATCTTCCTGCTGTCGCGCATTGCCCAT
TATCTGAAACTGATCCAGCGCGAGAACATCGGCACCACCAAAGATCGCCGTCTGCTGGAGCTGGAGCTGA
ACAACTGGGTGCGCGGGCTGGTGACGGAAATGACTGATCCGGGTGATGATTTGCAGGCGTCCCATCCCCT
GCGTGATGCCAAAGTGACGGTCGAAGATATCGAAGACAACCCCGGCTTCTTCCGCGTCAAGCTGTATGCG
GTGCCGCATTTCCAGGTGGAAGGGATGGACGTCAATCTGTCATTGGTTTCCCAAATGCCAAAGGCTAAGG
CATAA