SecReT6
Protein ID: 170023049
SecReT6 ID257
T6SS typei2
Gene symbol-
Locus tagYPK_0800
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]908889..910241 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDB1JN18
KEGG IDypy:YPK_0800
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-133, Aligned region: 18..447
Protein Sequence: 450 a.a.     [Download]
>gi|170023049|ref|YP_001719554.1| type VI secretion protein [Yersinia pseudotuberculosis YPIII]
MKIERPLWARGILVSPQQFQQQASWEAWTNECIAQMAVMHPWGVLQATFELDALAQGRLKAARLHVRFQD
GVLVDTECADVLPPTLTLAASLPAEASDATVMLAIPQLYANGGNCLQPDERGERPVRHRQAWRDVQNQFG
DDKKQVAVMYHQLTLRLDTQENGDYQVCPVARLLRDAQGRWTLDPGFIPPMLSLQASAWCGEQLELLMVQ
LRARLQRLMGMRRESNARMADFAVADVSLFWLLNALNSAEPVLGNFQRYPQVHPERLYQELARLAGSLLT
FSLEHEVTAIPVYQHEQLTRVFPPLFALLNILLEASLPSRVVAIELVHEPRINQWRATLRDPRLREGADF
YLSVRSSLPAAQLQTQFPQLCKAGAPDEVGNVVNVALSGIPLRPLSHVPAAIPLRLENQYFSLDLSHPAA
TQMMETGACVFYVPGTLGEIQLELFAVLRA
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|170022262|ref|NC_010465.1|:908889-910241 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGAAAATTGAACGCCCTCTGTGGGCTCGCGGGATCCTGGTGTCTCCGCAACAATTTCAACAACAGGCTT
CCTGGGAGGCCTGGACCAATGAATGCATTGCGCAAATGGCCGTGATGCATCCCTGGGGCGTGCTTCAGGC
CACTTTTGAATTGGATGCATTGGCACAGGGCCGCCTGAAAGCGGCGCGTTTGCATGTGCGTTTTCAGGAC
GGTGTGCTGGTGGATACCGAGTGTGCTGATGTGCTGCCGCCCACGCTGACGCTGGCCGCCAGTCTGCCCG
CCGAGGCCAGCGACGCCACGGTGATGCTGGCGATACCACAACTGTATGCCAATGGCGGTAACTGCCTGCA
GCCGGATGAGCGGGGCGAACGCCCGGTACGCCATCGTCAGGCCTGGCGCGATGTCCAAAATCAGTTCGGC
GATGACAAAAAGCAGGTCGCGGTGATGTACCACCAACTGACCCTGCGGCTGGACACTCAGGAAAACGGCG
ATTATCAGGTCTGCCCGGTGGCGCGTTTGCTGCGGGATGCGCAAGGTCGCTGGACACTGGATCCGGGCTT
TATTCCGCCGATGCTGAGCCTGCAGGCCAGTGCCTGGTGTGGCGAACAGCTTGAGTTATTGATGGTGCAA
CTGCGGGCGCGTTTGCAGCGTCTGATGGGGATGCGCCGGGAGAGCAATGCACGGATGGCCGATTTTGCTG
TTGCGGATGTGTCGCTGTTCTGGCTGCTCAATGCCCTTAACAGTGCCGAACCGGTATTGGGGAATTTTCA
GCGCTATCCGCAGGTTCATCCAGAGCGCCTGTATCAGGAACTGGCCAGGCTGGCGGGCAGCCTGCTGACG
TTCTCCCTTGAGCACGAAGTGACGGCGATCCCGGTTTATCAGCATGAACAACTGACCCGCGTCTTTCCCC
CGTTGTTTGCCCTGCTGAATATTCTGCTGGAAGCCAGCCTCCCTTCACGGGTAGTGGCGATTGAGCTGGT
TCATGAACCGCGTATCAATCAGTGGCGCGCGACCCTGCGTGACCCTCGTCTGCGCGAAGGGGCCGATTTC
TACCTGTCGGTCCGTTCCTCGTTGCCCGCGGCCCAATTGCAGACTCAGTTCCCGCAGTTGTGTAAAGCCG
GTGCGCCGGATGAGGTCGGTAACGTGGTGAATGTTGCGCTGAGTGGCATCCCACTGCGTCCGCTGAGCCA
TGTCCCAGCCGCCATCCCCTTGCGGCTGGAAAACCAGTATTTCTCCCTTGATCTCAGCCACCCTGCGGCG
ACGCAGATGATGGAGACGGGGGCCTGTGTGTTCTATGTACCCGGTACGCTGGGTGAGATCCAACTGGAGC
TGTTTGCGGTGCTACGCGCATGA