SecReT6
Protein ID: 170023050
SecReT6 ID257
T6SS typei2
Gene symbol-
Locus tagYPK_0801
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]910238..910924 [+]
Producthypothetical protein
NoteTssL
UniProt IDB1JNL0
KEGG IDypy:YPK_0801
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-45, Aligned region: 14..216
Protein Sequence: 228 a.a.     [Download]
>gi|170023050|ref|YP_001719555.1| hypothetical protein YPK_0801 [Yersinia pseudotuberculosis YPIII]
MNPHLTEHPPVGDIDALLQDTWLQVISLRQGVTCAEGEGLAFWQRCVADIERVHQALKDAGHSEQSCQHI
RYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHFFNTLDAGSQLYERMRAVLHEPAPDSAVLTCFHRVLM
LGFLGGYASPAASEREQLIDQLSVQVPAFSVAPSGGILASAASRNRLGIWLRYWPVRLGLAALMVALLWW
GLDHWLSGLLTTLLPEPV
 
Nucleotide Sequence: 687 bp     [Download]
>gi|170022262|ref|NC_010465.1|:910238-910924 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGAATCCTCACCTAACCGAACACCCCCCAGTCGGGGATATTGACGCCCTGTTACAGGACACCTGGCTAC
AGGTGATCAGCCTGCGTCAAGGGGTAACCTGTGCCGAGGGCGAAGGGCTGGCATTCTGGCAGCGCTGTGT
GGCGGACATTGAACGTGTCCATCAGGCGCTGAAAGACGCCGGTCACAGCGAGCAGAGTTGCCAGCACATC
CGATACGCCCAATGTGCACTGCTGGATGAGACCGTGAAAGGGCGCGGTGTACAGGATGACGCCTACTTTG
TGTGGTGTCATTCGCCCTTACAGGCGCATTTTTTCAATACCCTGGATGCCGGTAGCCAGCTTTACGAGCG
GATGCGCGCCGTGTTGCATGAGCCTGCGCCGGACAGCGCGGTACTGACCTGTTTTCACCGGGTATTGATG
TTGGGCTTCCTCGGCGGGTACGCCTCCCCGGCGGCTTCTGAACGGGAGCAACTGATCGATCAACTGAGCG
TGCAGGTACCGGCGTTCAGTGTCGCGCCATCCGGTGGGATCCTGGCAAGCGCCGCCTCCCGCAACCGGTT
GGGGATCTGGCTGCGTTACTGGCCGGTACGGCTCGGGCTGGCTGCGCTGATGGTTGCGCTGTTGTGGTGG
GGCCTTGATCACTGGCTATCCGGTCTGTTAACCACCTTACTGCCGGAGCCGGTGTAA