SecReT6
Protein ID: 170023051
SecReT6 ID257
T6SS typei2
Gene symbol-
Locus tagYPK_0802
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]910924..912660 [+]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDB1JNL1, B1JNL1
KEGG IDypy:YPK_0802
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.50E-15, Aligned region: 447..543
Protein Sequence: 578 a.a.     [Download]
>gi|170023051|ref|YP_001719556.1| OmpA/MotB domain-containing protein [Yersinia pseudotuberculosis YPIII]
MSRWWQRGLWLWAGLLAVILCLALLPLSPWGRWLMLAWVVLICMLGGSRAGRQAAGASSDPLFAGLATEN
GLLPENSRLPVVLVCGDGLASWFGRERSHQSAQGCWLRVDDISTLRQFARQLLWQRPEWAAQLAVMMVVN
PQQRRDERLLAADLQELRWQLMQLRRDSRHPVPLLLSSTVATSVARDTVWLSQQQTPPLTLWSTVSTPGS
LADWQRAESRAVQAERLKQAVLFSSQHDWLNAQVLPVLQAPNADVAPLAPQQIIQQQVASLADPVPASLW
QHWLAAHTTLTQVAGWHPPPPAAHDALPLPDFVFSALPLGSGVSSRRRVLRHGVTLLTLAAMVALCSSAW
QNRQLLHRVAFDIRQYHSVAMTDYSPKAQAVAVLRRDAGLLDEGYRNGEPLRLGLGLYRGERLRPPLLAA
IKSYIPPPPPPPAPPAPKTVRLDSLSLFDVGKFTLNAGSTKMLVTALIDIKAKPGWLIVVAGHTDITGDA
QANHILSLKRAEALRDWMLSTSDVSPTCFAVQGYGATRPIADNDTPDGRALNRRVEISLVPQADACQVPD
VKTASQDESDVSTQEMEK
 
Nucleotide Sequence: 1737 bp     [Download]
>gi|170022262|ref|NC_010465.1|:910924-912660 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGAGTCGGTGGTGGCAACGTGGGTTGTGGCTCTGGGCGGGTTTGCTGGCGGTCATCTTGTGTCTGGCAT
TGCTGCCGCTCTCCCCGTGGGGGCGCTGGCTGATGCTGGCATGGGTGGTGCTGATTTGCATGCTGGGCGG
GTCGCGGGCAGGGCGGCAAGCGGCCGGTGCATCCTCTGATCCGCTGTTCGCCGGGTTGGCAACTGAAAAC
GGTCTTCTCCCTGAAAACAGTCGCTTACCGGTGGTGTTGGTGTGTGGTGATGGTCTGGCGTCATGGTTTG
GTCGCGAACGGTCACACCAGAGTGCACAGGGCTGCTGGCTGCGGGTGGATGATATCAGCACCCTGCGGCA
GTTTGCCCGACAACTGCTGTGGCAACGGCCGGAATGGGCCGCTCAGTTGGCGGTGATGATGGTCGTGAAC
CCGCAGCAACGCCGCGATGAGCGCCTGCTGGCCGCCGATCTGCAAGAGCTGCGCTGGCAACTGATGCAAC
TGCGCCGCGATAGCCGCCATCCAGTTCCCTTGCTCCTGAGCAGCACGGTGGCCACCTCGGTTGCCCGTGA
TACGGTCTGGCTGTCACAGCAGCAGACACCGCCGCTGACACTCTGGTCAACCGTCTCGACGCCGGGCTCT
CTGGCCGACTGGCAGCGTGCGGAAAGCCGTGCCGTACAGGCTGAACGACTGAAACAGGCGGTGCTGTTCA
GCAGCCAGCATGACTGGCTGAACGCACAGGTGCTGCCGGTATTGCAGGCACCCAATGCGGATGTTGCCCC
CCTTGCCCCGCAACAGATTATTCAACAGCAGGTTGCCAGTCTGGCCGATCCGGTGCCTGCCTCGCTGTGG
CAGCACTGGCTGGCGGCGCATACCACGCTGACACAGGTGGCGGGTTGGCATCCACCGCCGCCCGCCGCCC
ATGACGCCTTACCGCTGCCGGATTTTGTCTTTTCAGCGCTTCCTCTTGGTAGCGGGGTGTCGTCACGCCG
TCGGGTACTGCGCCATGGTGTCACCTTACTGACGTTGGCGGCGATGGTGGCGTTGTGCAGCAGCGCCTGG
CAGAACCGGCAACTGTTGCACCGGGTGGCCTTTGATATCCGTCAGTACCACAGCGTGGCGATGACGGATT
ATTCCCCGAAAGCGCAGGCGGTGGCGGTATTACGCCGTGATGCGGGGCTGCTTGATGAAGGGTACCGCAA
CGGTGAACCGCTGCGTCTGGGCCTGGGGTTATATCGGGGGGAGCGGCTGCGCCCGCCGCTGTTGGCGGCG
ATCAAAAGCTACATCCCGCCGCCTCCTCCGCCTCCCGCGCCACCGGCGCCGAAAACCGTGCGTCTCGACA
GCCTGTCACTGTTCGATGTGGGTAAATTCACGCTGAATGCGGGGTCCACCAAAATGCTGGTCACGGCGCT
GATCGACATCAAAGCCAAACCCGGCTGGCTGATCGTGGTGGCGGGTCACACCGACATCACCGGCGATGCG
CAGGCCAACCACATTCTGTCGCTTAAACGCGCCGAAGCATTACGGGACTGGATGCTGTCAACCAGCGACG
TCTCGCCGACCTGCTTTGCGGTGCAAGGTTACGGGGCCACACGCCCTATCGCCGACAACGATACTCCCGA
CGGTCGGGCGCTCAACCGCCGGGTCGAAATCAGTCTGGTACCGCAGGCTGATGCCTGTCAGGTGCCGGAT
GTAAAAACAGCGTCACAGGATGAAAGTGACGTATCAACGCAAGAAATGGAGAAGTAA