SecReT6
Protein ID: 170023053
SecReT6 ID257
T6SS typei2
Gene symbol-
Locus tagYPK_0804
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]913543..916185 [+]
Producttype VI secretion ATPase
NoteTssH
UniProt IDB1JNL3
KEGG IDypy:YPK_0804
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.10E-40, Aligned region: 237..256
AAA_2 [PF07724], Evalue: 2.10E-40, Aligned region: 611..775
AAA [PF00004], Evalue: 1.00E-19, Aligned region: 239..351
AAA [PF00004], Evalue: 1.00E-19, Aligned region: 616..734
ClpB_D2-small [PF10431], Evalue: 7.80E-15, Aligned region: 782..860
AAA_5 [PF07728], Evalue: 8.80E-15, Aligned region: 239..263
AAA_5 [PF07728], Evalue: 8.80E-15, Aligned region: 337..369
AAA_5 [PF07728], Evalue: 8.80E-15, Aligned region: 615..736
AAA_16 [PF13191], Evalue: 2.20E-12, Aligned region: 115..197
AAA_16 [PF13191], Evalue: 2.20E-12, Aligned region: 216..260
AAA_16 [PF13191], Evalue: 2.20E-12, Aligned region: 284..317
AAA_16 [PF13191], Evalue: 2.20E-12, Aligned region: 471..532
AAA_16 [PF13191], Evalue: 2.20E-12, Aligned region: 588..659
AAA_16 [PF13191], Evalue: 2.20E-12, Aligned region: 680..710
AAA_16 [PF13191], Evalue: 2.20E-12, Aligned region: 753..797
AAA_25 [PF13481], Evalue: 1.90E-08, Aligned region: 239..304
AAA_25 [PF13481], Evalue: 1.90E-08, Aligned region: 293..327
AAA_25 [PF13481], Evalue: 1.90E-08, Aligned region: 613..644
AAA_22 [PF13401], Evalue: 4.40E-08, Aligned region: 238..324
AAA_22 [PF13401], Evalue: 4.40E-08, Aligned region: 614..652
Arch_ATPase [PF01637], Evalue: 4.10E-07, Aligned region: 217..254
Arch_ATPase [PF01637], Evalue: 4.10E-07, Aligned region: 291..391
Arch_ATPase [PF01637], Evalue: 4.10E-07, Aligned region: 608..654
Arch_ATPase [PF01637], Evalue: 4.10E-07, Aligned region: 685..702
IstB_IS21 [PF01695], Evalue: 6.90E-07, Aligned region: 232..300
IstB_IS21 [PF01695], Evalue: 6.90E-07, Aligned region: 615..635
NACHT [PF05729], Evalue: 2.90E-06, Aligned region: 239..325
NACHT [PF05729], Evalue: 2.90E-06, Aligned region: 615..636
NACHT [PF05729], Evalue: 2.90E-06, Aligned region: 743..760
Zeta_toxin [PF06414], Evalue: 5.90E-06, Aligned region: 234..263
Zeta_toxin [PF06414], Evalue: 5.90E-06, Aligned region: 448..517
Zeta_toxin [PF06414], Evalue: 5.90E-06, Aligned region: 614..655
AAA_19 [PF13245], Evalue: 1.10E-05, Aligned region: 236..260
AAA_19 [PF13245], Evalue: 1.10E-05, Aligned region: 613..637
AAA_14 [PF13173], Evalue: 1.70E-05, Aligned region: 239..336
AAA_14 [PF13173], Evalue: 1.70E-05, Aligned region: 614..705
AAA_17 [PF13207], Evalue: 5.40E-05, Aligned region: 239..304
AAA_17 [PF13207], Evalue: 5.40E-05, Aligned region: 614..651
Sigma54_activat [PF00158], Evalue: 5.80E-05, Aligned region: 220..253
Sigma54_activat [PF00158], Evalue: 5.80E-05, Aligned region: 615..732
Clp_N [PF02861], Evalue: 0.00075, Aligned region: 23..60
Clp_N [PF02861], Evalue: 0.00075, Aligned region: 111..125
Clp_N [PF02861], Evalue: 0.00075, Aligned region: 453..472
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 237..256
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 310..319
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 575..636
RNA_helicase [PF00910], Evalue: 0.0021, Aligned region: 240..261
RNA_helicase [PF00910], Evalue: 0.0021, Aligned region: 616..637
AAA_18 [PF13238], Evalue: 0.0024, Aligned region: 239..266
AAA_18 [PF13238], Evalue: 0.0024, Aligned region: 616..645
AAA_33 [PF13671], Evalue: 0.0061, Aligned region: 239..256
AAA_33 [PF13671], Evalue: 0.0061, Aligned region: 416..448
AAA_33 [PF13671], Evalue: 0.0061, Aligned region: 614..637
DUF258 [PF03193], Evalue: 0.0066, Aligned region: 221..257
DUF258 [PF03193], Evalue: 0.0066, Aligned region: 615..628
SRP54 [PF00448], Evalue: 0.0088, Aligned region: 239..260
SRP54 [PF00448], Evalue: 0.0088, Aligned region: 614..660
Protein Sequence: 880 a.a.     [Download]
>gi|170023053|ref|YP_001719558.1| type VI secretion ATPase [Yersinia pseudotuberculosis YPIII]
MTTHSAHLLRRLNPYCAQALAGAATLCQTRAHAEITVEHWLLKLLEQGEGDITVIARRYEWDMDSLWQGL
LAYLDTLPRTVQGKPQLSAALQQLIKSAWLDASLQENADAVRSVHLMAALINSPSLLAADAAWPLLSLST
TQLHRLLPLLDSQSDERPEIQQAAALADSPVNLTDEAATVTSASGQPQLNDALQAALDKFTLDVTAKARA
NQIDPIFGRDSEIRQMIDILSRRRKNNPILVGEPGVGKTALVEGLALRIADGNVPDSLKTVSVRTLDLGL
LQAGAGVKGEFEQRLKNVIEAVQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAAT
TWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKERYATHHGVHILDAAITAAVTLSRRFLTGR
QLPDKAVDLLDTAGARVRISIDTLPTALMAINAELAALAMEQQAIEQDLLLLPNVSSTRLPEIEQRRAAL
AVGQHTLEQQYKEEKRLTTLIIEARQDIANAAHLVALQEEFVQIQGNAPLLSLDVDVRTVAAVIADWTGV
PLGSLLKDEQTNLLSLENRLGERVIGQDAALGALAQRLRAAKTGLTSENGPLGVFLLVGPSGIGKTETAL
ALADSLFGGEKSLITINLSEYQEAHTVSQLKGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVEKAHRDV
LNLFYQVFDRGFMRDGEGREIDFRNTVIVMTANLGSDHLMQLLDEQPDAPDSTLHELLRPILRDHFQPAL
LARFQTLIYRPLQVDALKRIVAIKLNQVAQRLHCHYGLSCQIEDSLTDTLVAACLLPDTGARNIDSLLNQ
QILPVLSQQLLSRMSEQQRTTSLTLGWHEEDGITLTFEGE
 
Nucleotide Sequence: 2643 bp     [Download]
>gi|170022262|ref|NC_010465.1|:913543-916185 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGACAACGCATTCAGCACACTTATTACGCCGCTTAAATCCCTATTGCGCACAGGCACTGGCCGGTGCTG
CCACCCTGTGTCAGACCCGCGCCCATGCCGAGATCACTGTCGAACACTGGTTGTTAAAACTGCTGGAGCA
GGGCGAAGGCGATATCACGGTGATTGCCCGGCGTTATGAGTGGGACATGGACAGCTTGTGGCAAGGGTTA
CTGGCCTATCTGGATACTTTGCCGCGCACGGTACAGGGTAAACCCCAACTGTCCGCCGCGTTGCAGCAAC
TGATCAAAAGTGCCTGGCTGGATGCCTCGTTGCAGGAAAATGCTGATGCGGTGCGCTCGGTTCATCTAAT
GGCAGCGCTGATAAATTCGCCATCATTATTGGCCGCCGATGCCGCCTGGCCGTTGCTCAGCCTGAGCACT
ACCCAACTACACCGCTTGTTGCCGTTGCTGGACAGCCAATCCGACGAACGCCCTGAAATACAGCAGGCCG
CAGCACTGGCAGACAGCCCGGTCAATCTGACCGATGAGGCCGCGACGGTTACCTCCGCCAGTGGTCAGCC
GCAACTGAATGACGCGCTGCAAGCGGCGCTGGATAAATTTACCCTCGATGTCACCGCCAAAGCCCGTGCC
AACCAGATTGATCCGATTTTTGGCCGCGACAGCGAAATCCGCCAGATGATCGACATCCTGTCGCGCCGCC
GTAAAAACAACCCGATTTTGGTGGGTGAACCGGGTGTGGGTAAAACCGCGCTGGTTGAAGGGCTGGCACT
GCGGATTGCCGACGGCAACGTACCGGACAGCCTGAAAACCGTCAGTGTGCGCACACTGGATTTGGGTCTG
TTACAGGCCGGTGCCGGGGTCAAAGGCGAGTTCGAACAGCGCCTGAAAAATGTTATCGAGGCGGTGCAAC
AATCCCCCAGCCCGGTGCTGCTGTTTATCGACGAAGCCCACACCATTATCGGGGCCGGTAATCAGGCCGG
TGGTGCCGATGCGGCCAACCTGCTGAAACCGGCACTGGCGCGTGGCGAACTGCGCACCATCGCCGCCACC
ACCTGGTCCGAATACAAACAGTATTTTGAACGCGATGCCGCACTGGAGCGCCGCTTCCAGATGGTCAAAG
TGGACGAGCCGGATGATGACACCGCCTGCCTGATGCTGCGTGGCCTGAAAGAGCGCTACGCCACCCATCA
CGGCGTGCATATTCTGGACGCCGCTATCACCGCAGCGGTTACCCTGTCGCGCCGCTTCCTGACCGGCCGC
CAACTGCCGGACAAAGCGGTGGATCTGCTCGATACCGCCGGTGCCCGCGTGCGCATAAGCATTGACACCT
TGCCGACTGCGCTGATGGCGATTAACGCCGAACTGGCCGCACTGGCGATGGAGCAACAGGCCATCGAACA
GGACTTGCTCCTGCTGCCGAATGTCAGTTCAACGCGCTTACCTGAGATTGAGCAACGCCGCGCCGCGCTG
GCGGTTGGGCAGCACACACTCGAACAGCAATATAAAGAAGAGAAACGGCTGACCACCCTGATTATCGAGG
CGCGTCAGGACATCGCCAACGCGGCACATCTGGTCGCGTTGCAGGAGGAATTCGTTCAGATCCAAGGCAA
TGCGCCGCTGCTGTCGCTGGACGTTGATGTGCGCACTGTTGCGGCTGTGATCGCCGACTGGACCGGCGTG
CCGCTGGGCAGTTTACTCAAAGACGAACAAACCAACTTGCTGTCACTGGAAAATCGTCTGGGTGAGCGAG
TGATTGGGCAGGATGCGGCATTAGGTGCGCTGGCGCAACGGCTGCGGGCCGCCAAAACCGGCCTGACATC
AGAGAATGGCCCGCTGGGGGTGTTCCTGCTGGTCGGGCCGAGTGGGATCGGCAAAACCGAAACCGCGCTG
GCACTGGCCGACAGCCTGTTCGGCGGCGAGAAATCGCTGATCACCATCAACTTATCGGAGTATCAGGAAG
CTCACACCGTCTCCCAGTTGAAAGGGTCGCCCCCGGGCTATGTCGGTTACGGACAGGGCGGCGTATTGAC
CGAAGCGGTGCGCAAACGGCCTTACAGCGTGGTGCTGCTGGATGAAGTCGAGAAGGCCCATCGTGATGTG
CTGAACCTGTTCTATCAGGTGTTTGACCGCGGTTTTATGCGCGACGGTGAAGGGCGCGAAATTGATTTCC
GCAACACGGTCATTGTGATGACCGCCAATCTGGGCAGTGATCATCTGATGCAGTTGCTGGATGAGCAACC
GGACGCGCCGGACAGCACCCTGCATGAACTGCTGCGGCCGATCCTACGCGACCACTTCCAGCCCGCGCTG
CTGGCCCGCTTCCAGACCTTGATTTACCGCCCGCTTCAGGTGGATGCGCTCAAACGCATTGTGGCGATAA
AACTGAATCAGGTGGCGCAACGCCTGCACTGTCACTACGGCCTGAGCTGCCAGATTGAAGACAGCCTGAC
CGACACACTGGTCGCCGCCTGCCTGCTGCCGGACACCGGCGCACGCAACATCGACAGCCTGCTCAATCAG
CAGATTTTACCGGTATTGAGCCAGCAGCTGTTAAGCCGCATGAGCGAGCAACAGCGCACCACCTCGCTGA
CGCTGGGCTGGCATGAAGAAGATGGCATCACGCTGACATTTGAGGGCGAATAA