SecReT6
Protein ID: 170023054
SecReT6 ID257
T6SS typei2
Gene symbol-
Locus tagYPK_0805
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]916188..918536 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB1JNL4
KEGG IDypy:YPK_0805
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.30E-63, Aligned region: 34..355
DUF2345 [PF10106], Evalue: 1.10E-47, Aligned region: 610..751
T6SS_Vgr [PF13296], Evalue: 1.20E-34, Aligned region: 488..591
T6SS_Vgr [PF13296], Evalue: 1.20E-34, Aligned region: 589..618
Phage_base_V [PF04717], Evalue: 1.90E-15, Aligned region: 393..480
Protein Sequence: 782 a.a.     [Download]
>gi|170023054|ref|YP_001719559.1| ImpA family type VI secretion-associated protein [Yersinia pseudotuberculosis YPIII]
MNTFLPTIRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIGPATMLMHDASLTLAA
PMAEAFGVTVQQTQRVIQGVVTGFKRLSASKEECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLAEVGIWFRFTVDPKLNIDVVEFYDDQRFYQQ
GLTLQAVPPSGMHDSGMESVWDLSSAHQVVEKSVSTGDYNYRTATADLTAGADITRGDTTTYGEAYHYAD
NYLTAGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALAPGQELNVTGNDVPAQFGKGVIVTRI
TSHARRDRSYEVHFEAIPYSEENCFRPILINKPKMAGTLPARVTSTTVNDTYGHIDKDGRYRVNLMFDRD
SWEQGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAFEDGNPDRPYIAYVLHDSVHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFELRTDSFGVLRAEKGLFITAD
GQAKAQGQVLEMQPAIGLLQGAQEQMEAISADAQTATASPADLQAQISLLQQNLTELKQAVLLLSAPKGI
ALSSGEHLQMSASDNLIATAGKNADVSVAKNFFIGVGNTLSIFVRKLGMKLIANQGPITVQAQNDLMELL
ARKAITITSTEDEIKITAKKRITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRLDKAKLPTEFPALAA
KTEDPIKRWLFS
 
Nucleotide Sequence: 2349 bp     [Download]
>gi|170022262|ref|NC_010465.1|:916188-918536 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGAATACCTTTCTCCCGACTATTCGGTTTGACCATAGCCACCACAAACTGGTGGTCCGCGACAGCACCG
CCGCCGTTGATGTGCTGGGCTTTGAAGGCCATGAAAGCCTGAGCCAGCCGTTCTGTTACGACATCCAATT
CACCAGCGCCGACAAGGCGATTGGCCCGGCGACCATGCTGATGCACGACGCGTCACTGACATTGGCGGCC
CCGATGGCCGAAGCTTTTGGCGTGACGGTTCAGCAGACCCAGCGGGTGATCCAAGGGGTGGTCACCGGAT
TTAAACGCCTGTCGGCCTCGAAAGAGGAATGCCGCTACGAACTGAGCCTGCAACCGCGCCTGGCCTTGTT
ATCGCGCAGCCATCAGAACGGGATATATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGACATGCGCGGTCAGGATTTTGTCTTCACGCTGGCCCGCGAGTACCCACGCCGCGAGCAGG
TGATGCAGTATGGCGAGGATGACCTGACCTTTATCCGCCGCCTGCTGGCCGAGGTGGGGATCTGGTTTCG
TTTTACCGTCGATCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAGCGCTTCTATCAGCAA
GGACTGACGCTACAGGCGGTGCCGCCTTCGGGGATGCACGACAGCGGGATGGAATCGGTCTGGGACCTGT
CCAGCGCCCATCAGGTGGTGGAAAAATCGGTCAGTACCGGCGATTACAACTACCGCACCGCCACTGCCGA
CCTGACCGCCGGGGCCGACATCACGCGCGGCGATACCACCACCTACGGCGAAGCCTATCATTACGCCGAT
AACTATCTGACCGCAGGCAGCGAAGGGCGCGAGCCGGAAAGTGAAAGTGGGGCCTTTTATGCCCGTCTGC
GCCATGAACGTTACCTCAATAATCAGGCGCGCTTCGCCGGGGTGGCCAATGCGGCGGCACTGGCACCGGG
TCAGGAACTGAACGTCACCGGCAACGACGTGCCAGCACAATTTGGCAAAGGGGTGATAGTCACCCGCATC
ACCAGCCACGCCCGCCGCGACCGCAGCTATGAAGTGCATTTTGAGGCCATCCCTTACTCCGAAGAGAATT
GCTTCCGCCCGATCCTCATCAACAAGCCAAAAATGGCCGGCACCTTGCCCGCACGGGTCACCAGCACCAC
GGTGAACGACACTTACGGACACATCGACAAAGACGGCCGCTACCGTGTCAATCTGATGTTTGACCGGGAC
AGTTGGGAGCAAGGTTACGAAAGCCTGTGGGTCCGTCAGGCCCGCCCGTATGCGGGTGACAGCTACGGCC
TGCACCTGCCGCTGCTGGCCGGCACCGAAGTGGCGATTGCATTTGAGGACGGCAACCCGGACCGGCCGTA
TATCGCCTATGTGCTGCACGACTCGGTGCACGGCGACCACGTCACCATCAGTAATTACAAACGCAACGTA
CTGCGCACTCCGTCGAACAACAAACTGCGCCTGGAGGATGAACGGGGCAAAGAGCACATCAAGCTCAGCA
CCGAATACGGCGGCAAAAGCCAGTTGAATCTGGGGCATTTGGTCGATAACGAGAAACAGCCTCGGGGTGA
GGGTTTTGAGCTGCGCACCGACAGTTTTGGTGTATTACGGGCAGAAAAAGGCCTCTTTATCACTGCCGAC
GGACAGGCCAAAGCACAGGGGCAGGTGCTGGAGATGCAACCGGCTATTGGCCTGTTGCAAGGTGCTCAGG
AACAGATGGAGGCCATCTCCGCGGATGCACAAACCGCCACCGCCAGTCCGGCCGACCTGCAGGCACAAAT
CAGTTTGTTACAGCAAAATCTCACTGAACTGAAACAAGCTGTCCTGTTACTGAGTGCGCCAAAGGGGATC
GCGTTGAGTAGCGGGGAGCATCTGCAAATGAGTGCCAGCGATAACCTGATTGCCACCGCCGGTAAAAATG
CCGACGTCAGCGTCGCGAAAAACTTCTTTATCGGCGTAGGCAATACCCTAAGTATCTTCGTCAGAAAGCT
GGGGATGAAACTAATAGCCAATCAGGGGCCGATAACAGTCCAGGCGCAGAATGATCTAATGGAGTTATTG
GCGCGTAAAGCGATCACCATTACCAGCACCGAGGATGAGATAAAAATCACCGCCAAGAAGAGGATCACGC
TGAATGCGGGAGGCAGTTATATCACGCTGGATGAGAATCGGATCGAGTCAGGAACGGCGGGGGAATATTT
GACCAAAGCAGGGTATTACGGGCGGTTAGATAAGGCCAAGCTCCCAACTGAATTTCCAGCCTTAGCCGCT
AAAACTGAAGACCCCATTAAACGTTGGCTATTCTCTTAA