SecReT6
Protein ID: 170023708
SecReT6 ID258
T6SS typei3
Gene symbol-
Locus tagYPK_1467
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]1619849..1621531 [-]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDB1JG24, B1JG24
KEGG IDypy:YPK_1467
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 3.10E-18, Aligned region: 190..232
OmpA [PF00691], Evalue: 3.10E-18, Aligned region: 441..539
Protein Sequence: 560 a.a.     [Download]
>gi|170023708|ref|YP_001720213.1| OmpA/MotB domain-containing protein [Yersinia pseudotuberculosis YPIII]
MFKVKLNKTLSLLWLAAVGTLLVSVNFKGNALWNNVIFITFLALMVLAIWKHYALKPKHPQVPIPVPQET
AEPVEQESTVILILGPYAEKWFSNPESPDSTRFSSHAVWILITNPAALQKRLTYIAEHHPSAQVLTFFPF
LPDVYENAAVMMSKLTVWQNTFSTLSLRSPLPCVFAIYAQLSNERLSHNSDNAYWTGNINLANQQPIEIT
QALQSLSQRLELQDINHSGFATQRNVMAHNLFTWLNESGVTNLLQSIFSRTPLRLTDVILSDNGKGFIRH
GAWSAWLEKKFGIIPSLASTLSLPPFPAVINDQKPAIKPRVKTPVIKPIPASRGWLWSVCFAAVLLASHM
LNTLWQEKNRHAQFNQQMVPLDNINDFSAQYLARSITQLTDEGKTLTTCVNTFDVTRWGLSQCQTLLSQI
NRRIESYENIPVFSFAQKLPLFDSNSTKLKLNSQTNEMMMELLSLVEQNKGKKILIVGHSDNTGSSSMNM
TLSEQRALALRDWLIKRSDITVDNFITKGMGASEPVATNHTEAGREQNRRVEVLILPTQDRTRMTEPKPL
 
Nucleotide Sequence: 1683 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c1621531-1619849 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGTTTAAGGTTAAATTGAATAAAACGCTCTCTCTATTATGGCTGGCTGCGGTCGGCACCCTATTGGTGA
GTGTGAATTTTAAGGGAAATGCGTTATGGAATAACGTTATTTTCATTACTTTCCTGGCGCTGATGGTTCT
TGCCATCTGGAAACATTACGCCCTCAAACCCAAACACCCCCAAGTGCCGATTCCCGTCCCGCAGGAGACA
GCGGAACCGGTAGAACAGGAAAGTACGGTTATTTTAATTCTCGGTCCCTATGCTGAGAAATGGTTTAGTA
ACCCAGAATCGCCAGACAGTACACGTTTTTCCAGCCATGCGGTCTGGATATTAATCACGAATCCCGCCGC
GCTGCAAAAACGCCTCACATATATTGCTGAACATCATCCATCCGCTCAGGTATTGACCTTTTTCCCTTTC
TTGCCGGATGTCTATGAGAATGCAGCAGTGATGATGTCAAAACTCACGGTGTGGCAGAACACGTTTTCAA
CGTTATCACTGCGATCCCCCCTCCCCTGCGTATTTGCTATTTATGCGCAGTTGAGTAATGAACGCCTTAG
CCATAATTCTGATAACGCATATTGGACTGGAAATATTAATCTTGCGAACCAGCAGCCTATCGAAATTACG
CAAGCCCTACAGTCACTGAGCCAAAGACTTGAGTTACAAGATATCAATCACTCAGGATTTGCAACTCAGC
GTAATGTTATGGCCCATAATTTATTTACCTGGTTGAATGAATCGGGGGTGACAAACCTTCTGCAATCTAT
TTTCTCGCGCACCCCCTTACGGCTAACAGACGTCATTTTGTCGGATAATGGCAAAGGGTTCATCAGGCAT
GGTGCCTGGTCAGCCTGGCTGGAGAAAAAGTTTGGCATCATACCGAGCTTAGCCTCAACCTTGTCACTGC
CACCTTTCCCTGCGGTGATCAATGACCAGAAGCCCGCAATAAAACCACGGGTGAAAACACCGGTGATAAA
ACCTATCCCCGCATCCCGTGGGTGGTTATGGAGTGTGTGCTTCGCCGCGGTGCTATTAGCCTCACATATG
CTAAACACCCTGTGGCAAGAAAAAAACCGGCATGCGCAATTTAACCAACAGATGGTGCCGTTGGACAATA
TCAACGATTTTTCTGCTCAGTACCTGGCACGCAGCATCACCCAGTTAACCGATGAAGGTAAAACATTAAC
CACATGCGTTAATACATTTGATGTGACACGTTGGGGGCTGTCTCAATGTCAGACGTTATTAAGCCAAATC
AACCGCCGGATTGAATCCTATGAAAATATTCCTGTTTTCAGTTTTGCCCAAAAGCTCCCTCTGTTTGACT
CAAACAGTACCAAGCTGAAACTGAACTCACAAACCAATGAAATGATGATGGAGTTGTTATCACTGGTCGA
ACAGAATAAAGGGAAAAAAATCTTAATTGTTGGCCATTCTGATAACACGGGCAGTTCCTCCATGAACATG
ACACTTTCCGAACAGCGTGCGCTGGCCCTTCGCGATTGGTTAATTAAACGCAGTGATATCACTGTCGATA
ATTTTATTACCAAGGGAATGGGGGCTTCAGAACCGGTTGCGACCAATCACACGGAAGCGGGTCGAGAACA
AAACAGACGCGTCGAAGTACTGATATTACCCACACAAGATAGAACAAGAATGACGGAGCCTAAACCTTTA
TGA