SecReT6
Protein ID: 170023712
SecReT6 ID258
T6SS typei3
Gene symbol-
Locus tagYPK_1471
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]1624645..1625838 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDB1JG28
KEGG IDypy:YPK_1471
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.80E-18, Aligned region: 62..121
ImpA-rel_N [PF06812], Evalue: 3.80E-18, Aligned region: 203..215
Protein Sequence: 397 a.a.     [Download]
>gi|170023712|ref|YP_001720217.1| ImpA domain-containing protein [Yersinia pseudotuberculosis YPIII]
MSEQSIAERAGYYQSMMQPIPGDFPCGKNLEYDPAFIMLQTKLQPKQAAEYGNFVEVAEPNNWTDIERKC
LELLNNSRDIRLFIILMRCRMRQVGVGALQEGLEAILWCLDTWPDQLHPQLFDEGEFEPLMRGNAFAELE
DIDGFIADFRNQQLPKAAGVQLSIKEFEKAHSVPREEGALDEGTLEAVKQEWQNRSDHTILSLQHAYALL
QGLATRLNNSLGEDTPDFVRMTSVLRHFDAAITPIAPIVVPEPIETPDVVELYPVATAMLASTEMPVTAE
VQTVAETQMAIPIEAPQQRQAVVTPSPPLQPLQLQSAQLQPVPIQSPPVPVQQQGIQNRADALARLIEVR
EWFTAMEPSSPVIALLAFSEKTIGKSFGELLQFIPQELISKLNEGQE
 
Nucleotide Sequence: 1194 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c1625838-1624645 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGAGTGAACAGAGTATCGCTGAACGTGCCGGTTATTATCAAAGCATGATGCAGCCCATTCCAGGTGACT
TTCCTTGTGGCAAAAATCTGGAATATGACCCGGCATTTATTATGCTACAGACAAAATTGCAGCCTAAGCA
GGCCGCTGAATACGGCAATTTTGTTGAGGTCGCTGAACCCAATAACTGGACAGATATCGAGCGTAAATGC
CTTGAACTCCTGAATAATTCTCGGGATATTCGGCTGTTTATTATTCTGATGCGCTGCCGGATGCGTCAGG
TCGGTGTGGGCGCGTTGCAAGAAGGGCTGGAAGCCATACTTTGGTGCCTCGACACTTGGCCTGATCAGCT
ACATCCTCAGCTGTTTGATGAAGGGGAATTTGAACCTTTAATGCGCGGTAATGCTTTTGCTGAACTGGAA
GACATTGATGGTTTTATCGCCGACTTCCGTAATCAGCAGTTACCCAAAGCCGCTGGCGTGCAACTTTCCA
TCAAAGAGTTTGAAAAGGCACACTCCGTTCCTCGAGAAGAAGGGGCATTGGACGAAGGGACTCTGGAAGC
CGTCAAGCAAGAGTGGCAGAACCGATCAGATCACACCATTCTTTCACTCCAGCACGCTTATGCCTTGTTG
CAAGGATTAGCCACGCGCCTCAACAACTCCCTCGGTGAAGACACACCTGATTTTGTCAGAATGACCTCGG
TGTTACGCCACTTTGATGCCGCGATAACCCCGATAGCGCCTATCGTGGTGCCAGAACCTATTGAGACCCC
AGACGTTGTCGAGCTCTATCCGGTCGCCACAGCGATGCTAGCAAGCACAGAAATGCCAGTGACCGCCGAG
GTACAGACGGTTGCAGAGACACAAATGGCCATACCCATTGAGGCTCCCCAACAGCGTCAAGCGGTGGTAA
CCCCATCCCCGCCGTTGCAGCCGTTACAGTTGCAATCGGCACAGTTGCAACCTGTACCGATACAGTCGCC
GCCGGTGCCTGTCCAACAGCAGGGGATCCAAAACAGGGCTGATGCGTTAGCCCGGCTTATAGAGGTGCGA
GAGTGGTTTACCGCCATGGAACCGAGTAGCCCGGTCATTGCCTTACTGGCTTTTTCAGAAAAAACTATCG
GCAAAAGCTTCGGCGAATTGCTGCAGTTCATTCCTCAGGAACTGATTTCGAAACTCAATGAAGGACAGGA
GTAA