SecReT6
Protein ID: 170023713
SecReT6 ID258
T6SS typei3
Gene symbol-
Locus tagYPK_1472
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]1625937..1626962 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDB1JG29
KEGG IDypy:YPK_1472
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.50E-88, Aligned region: 22..321
Protein Sequence: 341 a.a.     [Download]
>gi|170023713|ref|YP_001720218.1| type VI secretion protein [Yersinia pseudotuberculosis YPIII]
MLPDESVHQEKHANLDAWYQESQPWNAGFISMMRANAARTPTLPAPGKAPLPEQEAFRIGQSAHMTFSPR
EISHAVMKDGKMDLQLFGLGIWGPNGAMPLQMTELAYTRAELHDHTMTDFVDLFHHRALSQLYRAWFVSQ
DTASLDRQSDEKFSFYVGSLAGLDPQELNDTELPVHARLASSAHLIREARNPEGLVGALQYYFDVPVRMV
EYAEQWIFLEESDQTQLGDGAGAMLLGDGAILGNTVLDRQHKFQLILGPLSLQQYLRFSLWGQDLPVLRE
WVRNFVGFEYAWEVQLLLSADEVPMATLDGGHQLGYTSWLARSDTTLDVGGMSFEPEMHHD
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c1626962-1625937 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGTTGCCCGATGAATCCGTTCACCAGGAAAAACATGCCAATCTGGACGCCTGGTATCAGGAGTCTCAGC
CATGGAACGCCGGTTTTATCAGCATGATGCGGGCGAATGCCGCCCGCACCCCTACCCTGCCAGCGCCAGG
AAAAGCGCCCTTGCCTGAACAGGAAGCCTTCCGCATCGGGCAAAGTGCGCACATGACGTTCTCTCCGCGT
GAGATATCTCATGCGGTTATGAAAGACGGGAAAATGGATCTGCAACTTTTTGGCTTAGGGATTTGGGGGC
CAAATGGTGCGATGCCGCTTCAGATGACCGAACTGGCCTATACCCGTGCCGAGTTGCATGATCATACGAT
GACGGACTTCGTCGACCTTTTTCATCACCGCGCATTATCACAGCTTTATCGGGCGTGGTTTGTCTCTCAG
GATACCGCCTCGCTAGACCGGCAGAGTGATGAAAAATTCTCCTTCTATGTCGGTAGTCTGGCCGGGCTGG
ATCCTCAAGAACTTAATGACACCGAACTCCCGGTTCATGCCCGGTTAGCCTCCTCTGCCCATTTGATTCG
TGAAGCGCGCAACCCCGAAGGGCTCGTGGGCGCATTGCAGTATTACTTTGACGTCCCCGTGCGGATGGTG
GAGTACGCCGAGCAGTGGATCTTTCTGGAAGAAAGCGACCAGACACAATTGGGTGATGGTGCCGGCGCGA
TGCTCTTGGGCGACGGTGCTATTTTGGGCAATACCGTTTTGGATCGGCAGCATAAATTTCAACTGATCCT
CGGCCCCCTCAGCCTGCAACAGTACCTGCGCTTTAGCCTCTGGGGACAAGACTTACCAGTATTGCGAGAG
TGGGTACGTAACTTTGTTGGGTTCGAATACGCCTGGGAAGTCCAGTTGTTGTTAAGCGCCGATGAGGTTC
CCATGGCAACACTCGATGGCGGACATCAATTGGGATACACCTCTTGGTTAGCCCGCAGTGATACCACCCT
TGATGTCGGTGGGATGAGTTTTGAGCCTGAAATGCATCACGATTAA