SecReT6
Protein ID: 170023714
SecReT6 ID258
T6SS typei3
Gene symbol-
Locus tagYPK_1473
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]1626962..1628842 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDB1JG30
KEGG IDypy:YPK_1473
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-202, Aligned region: 5..625
Protein Sequence: 626 a.a.     [Download]
>gi|170023714|ref|YP_001720219.1| type VI secretion protein [Yersinia pseudotuberculosis YPIII]
MDHKFLDYYNKELTFMREMAQEFAEKHPKIAGRLGMHGIEVADPYVERLIESFCFLSARTQIKLDAEFPK
FTQRLLDIVYPNYNSPTPSMGVIQLKPNLKEGDLTQGYCVPRGSSFFTHIAPGETTRCEFRSGQDVELWP
LEIAEARLSSVPPDMPNLEKHRIAYHRLKGALRIKLKLVGDLTFSQLEGLDRLPIYIDGDERIVSHIFEL
LHASHVATIIRAGHGETAKDTVISDQPLSFEGLSPDQSLLPLSWNIFHGHNLVQEYFTCRQRFYFFTLTQ
LSQSLRDNHTGEAEIIILLDRLPQDLVSHVAPSRFLLACTPVINLFPKRMDKIEINRALNDFHVVPDRSR
PLDYEVFAINKVFGQQAETSNEVVFNPLYQTRHCDNGNFGRYFSITRKARTGDSNKRKYDTRTPYASTEV
FVSLVDQQEAPYGDSLRYLSIEAQVTNRDLPRLISASGNFELTMSDSAPVHGARFVFQPSAPRAPFAMDE
SAWRLIRQLSFNYLPLSDMSHSNGGESLRNMLRLFVNASDHESNTQIDALVGCKSEPVIRRLPGNGLLVY
GRGICCTLTVDEEGFSGISPYLFGMIMENYVARHAAINVFTETELNSMQRGRVGHWKARPGRRGVL
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c1628842-1626962 Yersinia pseudotuberculosis YPIII chromosome, complete genome
GTGGATCACAAATTTCTTGACTATTACAATAAAGAACTCACTTTTATGCGCGAAATGGCGCAAGAGTTTG
CTGAAAAACATCCCAAAATAGCAGGCCGCCTGGGCATGCATGGGATTGAAGTCGCCGATCCTTACGTTGA
GCGGCTGATAGAGTCCTTCTGTTTTTTATCTGCCAGAACGCAGATTAAGTTGGATGCTGAGTTTCCTAAA
TTTACTCAGCGTCTTTTGGACATTGTCTATCCCAATTACAATTCGCCAACCCCCTCAATGGGCGTGATCC
AACTTAAGCCAAATCTGAAGGAAGGGGATTTGACTCAAGGGTATTGTGTTCCTAGGGGCAGCTCGTTCTT
CACCCATATCGCACCTGGCGAGACAACCCGCTGCGAGTTCCGTAGTGGTCAGGATGTGGAGTTGTGGCCA
CTGGAAATAGCAGAAGCGCGTCTAAGCTCTGTTCCCCCGGATATGCCTAATCTGGAAAAGCACCGCATTG
CCTATCATCGGCTTAAAGGTGCCTTACGCATTAAATTAAAATTAGTGGGCGATCTCACTTTCTCACAATT
AGAAGGCCTTGATCGGCTGCCTATTTATATTGATGGTGATGAACGAATCGTTTCACATATCTTCGAGCTA
CTCCACGCCAGCCATGTTGCTACCATCATACGGGCAGGCCACGGAGAGACAGCAAAAGACACCGTGATCA
GTGATCAGCCACTGTCCTTTGAAGGGCTAAGCCCCGACCAAAGCCTACTGCCGCTATCATGGAATATCTT
TCACGGACATAATCTGGTGCAGGAGTATTTTACCTGCCGCCAGCGTTTCTACTTTTTTACGCTGACACAG
CTGTCGCAAAGTTTGCGCGATAATCATACCGGTGAAGCGGAAATCATCATCCTACTGGACAGATTACCGC
AGGATTTGGTGAGCCATGTTGCCCCCTCTCGCTTCCTGTTAGCCTGCACGCCAGTGATTAATCTCTTTCC
TAAACGCATGGATAAGATCGAAATTAACCGTGCATTGAACGATTTTCACGTAGTACCAGACCGCAGCCGC
CCACTGGATTATGAAGTTTTCGCCATTAATAAAGTATTTGGTCAACAGGCGGAAACCAGCAACGAGGTGG
TATTTAACCCACTTTATCAAACCCGTCACTGTGATAATGGCAACTTTGGGCGTTATTTCTCCATCACCCG
CAAGGCCAGAACGGGCGATAGCAACAAAAGAAAATATGACACCCGCACGCCTTACGCCAGTACCGAGGTC
TTTGTCTCGTTGGTCGATCAACAAGAGGCGCCTTATGGCGATAGCTTGCGCTACCTCTCTATTGAAGCTC
AGGTGACTAATCGGGATCTTCCGCGCCTGATTTCCGCCAGTGGTAATTTTGAATTGACCATGTCGGATTC
AGCGCCCGTTCACGGTGCCCGGTTTGTGTTCCAACCCAGCGCCCCACGCGCCCCCTTTGCCATGGATGAA
TCCGCCTGGCGTTTGATTCGCCAATTGAGCTTCAACTATCTGCCACTGTCAGATATGTCCCACTCGAATG
GGGGGGAGTCACTGCGCAATATGCTACGTCTGTTTGTTAACGCTTCAGACCATGAATCGAATACACAAAT
TGACGCGCTGGTGGGCTGTAAAAGCGAGCCGGTGATCCGCCGGTTACCCGGCAATGGCCTACTGGTTTAT
GGCCGGGGCATCTGCTGCACCTTGACTGTGGATGAAGAAGGATTCTCCGGTATCAGCCCTTATCTATTTG
GCATGATCATGGAAAATTATGTGGCCCGCCATGCCGCAATAAATGTGTTTACCGAGACCGAGCTAAACTC
CATGCAAAGAGGACGTGTCGGTCACTGGAAAGCCCGCCCTGGCAGACGAGGAGTCCTGTAA