SecReT6
Protein ID: 170023723
SecReT6 ID258
T6SS typei3
Gene symbol-
Locus tagYPK_1482
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]1640577..1641137 [+]
Producthypothetical protein
NoteTssJ
UniProt IDB1JG39
KEGG IDypy:YPK_1482
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.00E-36, Aligned region: 29..179
Protein Sequence: 186 a.a.     [Download]
>gi|170023723|ref|YP_001720228.1| hypothetical protein YPK_1482 [Yersinia pseudotuberculosis YPIII]
MILIRLSMNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLTVEIATAADINPNDKGVANPLRIA
LYTLKSTDEFQSSDFFTITEENTPSLKEQMDNVFDRIMLPSETKKIELTLDAGVTAIGIVAAYREIEQAE
WKAVIYPLPKKRVDPWYKKMWPGQDQQDPIMKVRVERLSISIKEMD
 
Nucleotide Sequence: 561 bp     [Download]
>gi|170022262|ref|NC_010465.1|:1640577-1641137 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGATTTTAATTAGGCTAAGTATGAATAAAAGTATCCGAGGGGTTTACCGGGCGACACAGTACTTATTTT
TGGTACTGGTAACGTTATTGACGATAGCCTGTAGTTCAAAAGTGCAACCTGAAAAGGCTGAAAAACTTAC
CGTCGAAATCGCGACAGCAGCGGATATTAATCCGAATGATAAAGGGGTGGCGAACCCGCTAAGGATTGCG
CTTTATACACTCAAGAGCACCGATGAATTTCAGTCGAGTGATTTCTTCACTATCACTGAAGAAAATACGC
CATCGCTAAAAGAACAAATGGATAACGTGTTTGACCGGATTATGTTGCCAAGCGAGACCAAAAAAATAGA
GCTGACACTTGATGCTGGCGTTACTGCTATCGGCATCGTGGCTGCTTATCGTGAAATTGAACAGGCGGAG
TGGAAAGCGGTTATTTATCCGTTGCCCAAAAAGCGCGTGGACCCTTGGTATAAAAAAATGTGGCCAGGGC
AAGACCAACAAGATCCGATCATGAAGGTACGCGTTGAGCGTCTGTCAATATCAATTAAAGAAATGGATTA
A